KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4054Help
Entry
Reut_B4054        CDS       T00268                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00220  Arginine biosynthesis
reu00330  Arginine and proline metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01130  Biosynthesis of antibiotics
reu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Reut_B4054
   00330 Arginine and proline metabolism
    Reut_B4054
Enzymes [BR:reu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Reut_B4054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAZ63410
UniProt: Q46TX4
Position
2:693950..694864
Genome map
AA seq 304 aa AA seqDB search
MKPITLFGAPTDVGASTRGCTMGPEALRIADIVPALARMGLDVSDAGNIAGPVNPLAPPV
QGLRHLDEVVAWNRGVFEASTRILQAGRMPVLLGGDHCLAVGSVSAVARHCREAGRKLVV
LWLDAHADANIGTSTPTGNMHGMPVACLCGDGPTPLTTLGGQPPAVRPEEIRQVGIRSVD
AQEKLRLHALGLKVFDMRYIDEYGMRQTMEQALAGVDDDTHLHVSFDVDFIDSAIAPGVG
TTVLGGPTYRETQLCMEMIADTGRLSSLDVMELNPACDVRNETARLVVDFLESLFGKSTL
LRAR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgattaccctgtttggcgcgccgacggatgtcggcgcaagcaccagaggctgc
acgatgggccccgaagcgctgcgcattgccgacatcgtcccggcgcttgcgcggatgggg
ctcgatgtcagcgacgccggcaatattgctggtccggtgaatccgctcgcgccgccggta
cagggcctgcgccatctcgatgaggtggtggcgtggaatcgcggcgtgttcgaggccagt
acgcgcattctccaggcgggccggatgccggtcctgcttggcggtgaccactgcctggcg
gtcggatcggtcagtgcagtcgcccgtcattgccgggaggcaggccggaagctcgtcgta
ctctggctcgatgcccatgccgatgccaatatcgggaccagtacgccgaccggcaatatg
catggcatgccagtggcctgcctgtgcggcgacggccccacgccactgaccacgctcggc
ggccagccgccggcggtacgtcccgaggaaatccggcaagttggcatccgcagcgtcgat
gcgcaggaaaagctgcggctgcatgcgctgggcctcaaggtgttcgatatgcgctatatc
gacgagtacggcatgcgccagaccatggagcaggcgctcgccggcgttgatgacgacacg
cacctgcacgtgagcttcgacgtcgatttcatcgattcggccatcgcgcccggcgtcggt
acgacggtgctgggcggacccacgtatcgcgagacacaactctgcatggaaatgatcgct
gatacgggacgattgtcttcgctggacgtaatggagctcaaccctgcctgcgatgtgcgt
aatgagacagcacggctggtggtcgatttcctggaaagcctgtttggcaagtccacgcta
ctgcgggcgcgctga

DBGET integrated database retrieval system