KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5261Help
Entry
Reut_B5261        CDS       T00268                                 

Definition
(GenBank) Protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Reut_B5261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reu02044]
    Reut_B5261
Secretion system [BR:reu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Reut_B5261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AAZ64607
UniProt: Q46QH7
Position
2:complement(2011957..2012442)
Genome map
AA seq 161 aa AA seqDB search
MAIPAYMWIKDDGGADIKGSVTVSGREGSVEVVAFDHAVNIPTDSNTGKLTGTRVHKPIV
FTKETDASTPYLYKAVTSGQTLKSIEIKWYKIDDAGKEKEYFNTKLENVKVVGVTPKMLD
IKNPAYEKHNHLEDIELRYEKIIWSYKDGNIIHADSWNERS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcccgcatacatgtggatcaaggacgacggcggagccgatatcaagggctcg
gtcaccgtgtccggccgcgagggcagcgtcgaagtcgtcgccttcgaccacgccgtcaac
atcccgaccgactcgaacaccggcaagctgaccggcacccgcgtgcacaagccgatcgtg
ttcaccaaggaaacggatgcctcgaccccctacctgtacaaggcggtcaccagcggacag
acgctgaagtcgattgagatcaagtggtacaagatcgatgacgccggcaaggagaaggag
tacttcaacaccaagctggaaaacgtcaaggtggtcggcgtcacgccgaagatgctggac
atcaagaacccggcctacgaaaaacataaccatctcgaggacatcgagctgcgctacgag
aagatcatctggtcgtataaggacggcaacatcattcacgccgacagctggaacgagcgc
tcataa

DBGET integrated database retrieval system