KEGG   Ralstonia eutropha JMP134: Reut_B5327Help
Entry
Reut_B5327        CDS       T00268                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00052  Galactose metabolism
reu00500  Starch and sucrose metabolism
reu00520  Amino sugar and nucleotide sugar metabolism
reu00521  Streptomycin biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_B5327
   00052 Galactose metabolism
    Reut_B5327
   00500 Starch and sucrose metabolism
    Reut_B5327
   00520 Amino sugar and nucleotide sugar metabolism
    Reut_B5327
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Reut_B5327
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Reut_B5327
Enzymes [BR:reu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Reut_B5327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAZ64672
UniProt: Q46QB2
Position
2:complement(2092277..2093308)
Genome map
AA seq 343 aa AA seqDB search
MSNAMAASAVPDDTAYPRLLADVGGTNVRFALETAPMQIGAVTALKVADHPSLEAAMRHY
RDALSASGAKLPRHAAIGLANPVTGDHVRLTNHDWAFSIEATRQALGLQTLVAINDFTSL
ALGLPYLGANDLVQIRSGQAVATAPRALIGPGTGLGVSGLVPAPGGGAVALAGEGGHIEL
MPVTDDEWIAWRATHASLGRVSAERLLSGMGLSQIHAALSAETGTRVDVPLTPEQVTTGA
FARHDPLCERTMAVFFGLLGSVAADIALVMGALGGVYLGGGILPRFVPALQASAFNARFV
AKGRMRGYLDKLPVYVITASYPALPGLARALADTLSHGRPHIG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgccatggctgcttccgccgtgcccgatgacaccgcctatccgcgtttgctg
gccgacgtgggcgggaccaatgtgcgcttcgcactggaaacggcgccgatgcagatcggc
gccgtgaccgcgctgaaggtggccgaccatccgtcgctggaagcggccatgcgccactac
cgcgatgcgctgtctgcctcgggtgccaagttgccgcgccatgctgccatcggtctcgcg
aatccggtcacgggcgaccacgttcgcctgaccaaccacgactgggccttctcgatcgaa
gccacgcggcaagcgctcgggctgcagacgctcgtggccatcaacgatttcacgtcgctg
gcgctgggcttgccttaccttggcgcgaacgatctcgtgcagatccgctccggccaagcc
gtggccactgcgccgcgtgcgctgatcgggcctggcaccgggttgggcgtgtcggggctg
gtgcccgcgccgggcggtggcgccgtggcgctggcgggggagggcggccatatcgaactc
atgcccgtgaccgacgacgagtggatcgcctggcgcgccacgcacgcgagccttgggcgg
gtgtcggcggagcggttgttgtcaggcatggggctgtcgcagatccatgccgcgctgtcc
gcagaaacgggtacgcgcgtggacgtgccgctgacgcccgagcaggtcacgacgggtgcc
ttcgcacggcacgatccgctctgcgagcgcaccatggcggtgttttttggcctgctcgga
tctgtcgcagcggacatcgcgctggtaatgggcgcgcttggcggcgtgtatctcggtggc
ggcatcctgccgcgcttcgtgccagcgctgcaggcgtcggccttcaatgcgcgcttcgtc
gccaagggccgcatgcgcggctatctcgacaagctgcctgtctacgtgattaccgcgagc
tatcccgcgctgccgggcctggcgcgcgcgctggccgatacgctcagtcacggccgccca
catatcggataa

DBGET integrated database retrieval system