KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5662Help
Entry
Reut_B5662        CDS       T00268                                 

Definition
(GenBank) Haloacid dehalogenase, type II:HAD-superfamily hydrolase, subfamily IA, variant 2
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00625  Chloroalkane and chloroalkene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Reut_B5662
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5662
Enzymes [BR:reu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Reut_B5662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Terminase_4 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AAZ65007
UniProt: Q46PC7
Position
2:complement(2491537..2492280)
Genome map
AA seq 247 aa AA seqDB search
MPRDTLVSHRQSVDIGGKFSGKTVLTLDVYGTLIDWERGICDALGPILRGHGLSTSEDEM
LERYATHESALEAGPYLTYREILEESLLRIAADLGFTPSEYELDIFSHSVGDWPAFADSR
AALVALQKRFRLAVITNGDDEFFSLSNKHLKIQFDYVVTAQQARSYKPSLNNFHVALGRI
DAPRSQILHVAQSLYHDHVPAQALGLQTVWINRRRGKPGFGAVPKAEAVPDAEFDDMRAF
ADAMLER
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagacacgttagtcagtcaccgacaatcggtagatattggcggaaagttttcc
ggcaagacggtgctgacgttagacgtctatggcacgctgatcgactgggagcggggcatt
tgcgatgcattgggaccaatcctgaggggccacggattgtcgacgagcgaagacgagatg
ctggagcggtacgcgacgcatgagtccgcgctggaagcaggcccctacctgacatatcgg
gaaattctggaggagtcgctgctgcgcattgcggcagatcttggattcactccctcggaa
tacgaactcgacatcttttcgcattcggtcggtgactggccggcctttgccgattctcgg
gccgcactcgtcgcgcttcagaagcgttttcggctggccgtcatcacgaatggtgacgac
gaattcttctcgctttccaacaagcacctgaagatccagttcgactacgttgtcacggct
cagcaggcccgcagctacaagccgtcgttgaacaacttccatgtggcgcttggccggatc
gacgcaccgcgatcgcagatcctgcatgtcgcgcaaagtctgtatcacgaccatgtcccg
gcccaggcgctgggcctgcagactgtttggatcaaccgacgacgcggcaagcccggtttt
ggcgccgttccgaaggccgaagccgtacctgacgccgaattcgacgacatgcgagccttc
gccgacgcgatgctggaacggtag

DBGET integrated database retrieval system