KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5675Help
Entry
Reut_B5675        CDS       T00268                                 

Definition
(GenBank) toluene 4-monooxygenase protein E
  KO
K15764  toluene monooxygenase system protein E [EC:1.14.13.236 1.14.13.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5675
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Reut_B5675
    1.14.13.-  
     Reut_B5675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_Hydrox
Motif
Other DBs
NCBI-ProteinID: AAZ65020
UniProt: Q46PB4
Position
2:complement(2508847..2509845)
Genome map
AA seq 332 aa AA seqDB search
MTTQPDVLKPLKTWSHLAARRRKPSEYEIVSTNLHYTTDNPDAPFELDPNFEMAQWFKRH
RNASPLKHADWNAFRDPDELVYRTYNMLQDGQETYVSGLLDQFSERGHDSMLEHSWAGTL
ARLYTPARYLFHALQMGSAYLTQMAPASTISNCAAYQTADSLRWLTHTAYRTRELSQTFG
DVGFGTDERRYWEQDPAWQGWRKLVEHALVAWDWAECFVAFSLVLRPAMEEAVLRGLGEA
ARHNGDTLLGLLTDAQLADVQRHRHWAGALVRMALETPGNRDVLAGSIARWAPLADDAIS
AYCAALPDAPNAKARACAAVRDFWDSIGLAGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcaacccgacgtcctcaagccgctgaagacctggagccacctggccgcgcgc
cggcgcaagccgagcgagtacgagatcgtctcgacgaacctgcactacacgaccgacaac
cccgacgcgccgttcgagctcgatccgaacttcgagatggcgcagtggttcaagcgtcac
cgcaacgcctcgccgctgaaacacgccgactggaacgccttccgcgatcccgacgaactc
gtctaccgcacctacaacatgctgcaggacggccaggaaacctatgtgtccggcctgctg
gaccagttttctgaacgcggccacgactccatgctggagcactcctgggccggcacgctg
gcgcggctgtacaccccggcacgctatctgttccacgcactgcaaatgggatccgcctac
ctgacgcagatggcccccgcatccacgatctcgaactgcgccgcctaccagaccgccgac
tcgctgcggtggctgacccacaccgcatatcgcacgcgagagctgtctcagaccttcggc
gacgtgggctttggcaccgacgagcgcaggtactgggagcaggacccggcctggcagggc
tggcgcaagctggtcgaacacgcgctcgtggcatgggactgggcagagtgcttcgtcgcc
ttcagcctggtattgcggccggcgatggaggaagccgtcctgcgcgggcttggcgaggcg
gcgcgccacaacggcgacaccctgctcggcctgctgactgacgcgcagcttgccgacgtc
cagcggcaccggcactgggccggcgcgctcgtccgcatggccctggagacgccgggcaat
cgtgacgtgctggccggctcgattgcccggtgggcgccgctcgcggacgatgcaatcagt
gcctactgcgcggcgttgcccgacgcgccgaacgcgaaggcgcgggcctgcgcggccgtg
cgcgacttctgggacagcatcggcctggcaggtctgtaa

DBGET integrated database retrieval system