KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5686Help
Entry
Reut_B5686        CDS       T00268                                 

Definition
(GenBank) Ferredoxin
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2
Motif
Other DBs
NCBI-ProteinID: AAZ65031
UniProt: Q46PA3
Position
2:2517567..2517932
Genome map
AA seq 121 aa AA seqDB search
MPDERPKVDVCVEQTQEHYVCATSESLLAGMLRLGRKGIPVGCINGGCGVCKVRVIEGRT
TRLGPLSRAHVSAEEEAQGITLACREAPLTAVRLAVLGRIEKSFFKGFAASAGAQPDHKP
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgaaagaccaaaggttgacgtctgcgtggagcagacccaggagcactacgtc
tgcgcgacgagcgaaagcctgctggccggcatgttgcgccttgggcgcaagggcatcccg
gtgggctgcatcaacggcggctgcggggtatgcaaggtgcgcgtcattgaaggccgcacg
acgcgactggggccgctcagccgggcgcacgtcagcgctgaagaagaagcacagggcatc
acgctggcatgccgcgaggcaccgctgaccgccgtgcggcttgccgtgctgggccggatc
gagaaatcgttcttcaagggcttcgccgcgtctgcgggggcgcagcccgaccacaaaccg
cagtga

DBGET integrated database retrieval system