KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5688Help
Entry
Reut_B5688        CDS       T00268                                 

Definition
(GenBank) Protein of unknown function DUF336
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haem_degrading
Motif
Other DBs
NCBI-ProteinID: AAZ65033
UniProt: Q46PA1
Position
2:2518948..2519397
Genome map
AA seq 149 aa AA seqDB search
MSLTASDALCVSEPRPHITLPAAQAAVTAAVAAAAEQGLRINVAVVDGGGALVAFARMTG
AFLHSIDIAIDKARTSASFGFPTAQWGELLAGDEPLRLGLATRPGLVIFGGGLPMREKGE
VIGGIGVSGGSAAQDEACARAGLHAIGLQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaccgcttccgacgcgctctgtgtgagcgaacctcgtccccatatcacgctg
cctgccgcacaggccgcggtgacggccgcggtggcggcggcagcggagcagggcctgcgc
atcaacgtggccgtggtggatggcggtggcgcgctggtggcctttgcgcgcatgacgggt
gccttcctgcactcgatcgacattgccatcgacaaggcgcgcacgtcggccagcttcggc
tttcccactgcgcagtggggcgagttgcttgccggtgacgagccgttgcgtcttggcctg
gcgactcgcccgggactggtgatcttcggcgggggtctgccgatgcgcgagaagggcgag
gtgatcggcggcatcggcgtgtccggcggctcggccgcacaggacgaagcttgtgcacgc
gccggcctgcacgccatcggcctgcaatga

DBGET integrated database retrieval system