KEGG   Ralstonia eutropha JMP134: Reut_B5690Help
Entry
Reut_B5690        CDS       T00268                                 

Definition
(GenBank) 2-hydroxymuconate semialdehyde hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00362  Benzoate degradation
reu00622  Xylene degradation
reu00643  Styrene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5690
   00622 Xylene degradation
    Reut_B5690
   00643 Styrene degradation
    Reut_B5690
Enzymes [BR:reu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     Reut_B5690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_4 Esterase Thioesterase FSH1 BAAT_C
Motif
Other DBs
NCBI-ProteinID: AAZ65035
UniProt: Q46P99
Position
2:2520898..2521749
Genome map
AA seq 283 aa AA seqDB search
MSESDFQVPETRYVRTGAVTTHIHDVGRGSPVLLLHGSGPGVSAWANWRPVLPALARERR
VIAPDMLGFGQSDRPAGQVYGMDVWVQQALDLLDALELPQVDLVGNSFGGALALALAIRA
PGRVRRLVLMGSVGVPFRITSGLEAVWGYEPSLTAMRGLLDLFAYDRGRVTDELARLRYE
ASVAPGVQESYGAMFPAPRQRWVDAMASAEADIRALPHETLVVHGREDKVIPLSNSLTLA
DWIPNSQLHVFGRCGHWTQIEHSARFATLVSNFLAEADAAAVA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagcgattttcaggtacccgagacccgctacgtgagaacaggtgcggtgaca
acgcacatccatgacgttggccggggttcgcccgtgctgctgctgcacggatccggccca
ggggtcagcgcgtgggccaactggcgcccggtgctgccggcgctggcccgtgaacgccgc
gtcatcgcgccggacatgcttggcttcggccagagcgaccgtccggccggacaggtctac
ggcatggacgtctgggtgcagcaggccctggacttgctcgatgcactggaactgccgcag
gtcgatctcgtcggcaactcgtttggcggggcgctggcgctggcgcttgccatccgtgca
ccggggcgggtgcggcggcttgtgctgatgggatcggtcggggtgccattccgcatcacg
tcggggctggaggcagtgtggggctatgagccgtcactgacggcaatgcgggggctgctg
gacctgttcgcctacgaccgtggccgtgtgaccgacgaactggcccggctgcggtacgaa
gccagcgtggcacctggcgtgcaggaatcctatggcgccatgtttcccgcgccgcgccag
cggtgggtcgacgcgatggcgagcgccgaggcggatattcgcgcgctgccgcacgagacg
ctggtggtccacggcagggaagacaaggtcatcccgctgtctaattcgctgacgctggcg
gactggattcccaacagccagctccatgtattcggccgttgcggccactggacacagata
gagcacagcgcgcgcttcgcgacgctggtgagcaacttcctggccgaagccgacgccgct
gcagtcgcttga

DBGET integrated database retrieval system