KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5691Help
Entry
Reut_B5691        CDS       T00268                                 

Definition
(GenBank) 4-oxalocrotonate decarboxylase
  KO
K18364  2-oxopent-4-enoate/cis-2-oxohex-4-enoate hydratase [EC:4.2.1.80 4.2.1.132]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5691
   00622 Xylene degradation
    Reut_B5691
   00621 Dioxin degradation
    Reut_B5691
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.80  2-oxopent-4-enoate hydratase
     Reut_B5691
    4.2.1.132  2-hydroxyhexa-2,4-dienoate hydratase
     Reut_B5691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: AAZ65036
UniProt: Q46P98
Position
2:2521778..2522560
Genome map
AA seq 260 aa AA seqDB search
MDAIKTQHYGDALYESLLTRKPLEPLTDREPDITIEDAYQIQLRMIGRRLEAGETVIGKK
IGVTSRVVMDMLGVDQPDFGHLLSGMVFNEGEPVDTGKMIAPKAEAEVAFVLSRDLCGPG
LTAADVLRATDCVMPCFEIVDSRIRDWKIRIQDTVADNASCGVFTLGGTRRSPRDLDLAL
AGMVLEKNGEIVSTSCGASVQGSPVNAVAWLANTLGRFGIALKAGDVILSGSQSPLVPVK
PGDSLYCSVGGLGGTSVRFI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacgccataaagacccaacactacggcgacgcgctctacgaatcgctcctgacgcgc
aagccgctggaaccactcaccgaccgcgagccggacatcaccatcgaagacgcctaccag
atccagttgcgcatgatcggtcgccgcctggaagcgggcgagaccgtgatcggcaagaag
atcggcgtgaccagccgggtggtgatggacatgctcggggtggaccagcccgacttcggt
catctgctgtccggcatggtcttcaacgagggcgaaccggtggacacgggcaagatgatc
gcgccgaaggcggaggcagaagtggctttcgtgctgtccagagacctctgcgggccgggc
ctgaccgcagccgatgtactgcgtgctaccgattgcgtgatgccgtgcttcgagatcgtc
gattcccgcatccgagactggaagattcgcatccaggacaccgtggccgacaatgcctca
tgcggcgtcttcacactcggcggcacgcgccgcagcccgcgcgacctcgatctcgcgctg
gcaggcatggtgctggagaagaacggcgagatcgtgagcacctcgtgcggcgcctcggtg
caaggctcgcccgtcaatgcggtggcgtggctggcgaatacgctgggccgcttcggcatc
gcgctgaaggcaggcgacgtgatcctgtcgggctcgcagtcgccgctggtgcccgtcaag
ccgggcgacagcctgtattgcagcgtgggcgggctgggcgggacctcggtgcgcttcatc
tga

DBGET integrated database retrieval system