KEGG   Ralstonia eutropha JMP134: Reut_B5693Help
Entry
Reut_B5693        CDS       T00268                                 

Definition
(GenBank) 4-oxalocrotonate isomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5693
   00622 Xylene degradation
    Reut_B5693
   00621 Dioxin degradation
    Reut_B5693
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     Reut_B5693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase Tautomerase_2 Tautomerase_3
Motif
Other DBs
NCBI-ProteinID: AAZ65038
UniProt: Q46P96
Position
2:2523558..2523749
Genome map
AA seq 63 aa AA seqDB search
MPFAQIYMIEGRTVEQKRAVIQKVTSALVEATGAPKENVRVWIHDVPKENWGIAGESAKD
LGR
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgcgcagatctacatgattgaaggccgcacggtggaacagaagcgtgccgtt
atacagaaagtcacttctgccttggtggaggcgacgggagcgccaaaggaaaatgtacgc
gtctggatccacgatgtaccaaaggaaaactggggaattgccggcgagtcggctaaagac
cttgggcgctag

DBGET integrated database retrieval system