KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5697Help
Entry
Reut_B5697        CDS       T00268                                 

Definition
(GenBank) putative outer membrane porin signal peptide protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4
Motif
Other DBs
NCBI-ProteinID: AAZ65042
UniProt: Q46P92
Position
2:2526053..2526445
Genome map
AA seq 130 aa AA seqDB search
MGGYRWGFTEFANGATLSRDDFWWAGGSYQATTALNFQLGYYYWNIKSLRLGATATEGNP
ANPWEVAFVADYAFSKRTDVYLTTAYARNAGVNFDSSNTGFATGYFPTPGQRGMTAVAVG
GPPHFLRELS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgggaggctaccgctggggtttcactgagttcgcgaacggagcaacgctgtcgcgcgac
gacttctggtgggcgggcggcagctatcaggctaccactgcgctgaatttccaacttggc
tactactactggaacatcaagtctctacgactcggtgcaactgctactgaaggcaatccg
gcaaatccgtgggaagtcgcattcgtggcggactacgcgttctcgaagcgcacggacgtc
tacctgacgacggcgtacgcccgcaatgccggcgtgaacttcgattcgtcgaatacgggc
tttgcgaccggctactttccgacaccgggacaacgcgggatgaccgccgtcgcagtgggg
gggccgcctcattttctaagggagctgtcatga

DBGET integrated database retrieval system