KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5709Help
Entry
Reut_B5709        CDS       T00268                                 

Definition
(GenBank) Cupin region
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_3 3-HAO Cupin_7 Cupin_1 MannoseP_isomer Cupin_6
Motif
Other DBs
NCBI-ProteinID: AAZ65053
UniProt: Q46P81
Position
2:2536454..2536879
Genome map
AA seq 141 aa AA seqDB search
MSQSSNHTIAPAERGQCQAIDLAGKIAQIDGHWQPRVVAEMNDYQFKVVKVKGEFQWHRH
AGTDETFIVLEGELRIDFRAGPSGDGSIMLRAGQMAVVPKGVEHKPRASAEVKLLLIEPR
GVVNTGDGATGERTVENDQWI
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatcctcgaaccacaccatcgcgccggccgagcgcggccagtgccaggccatc
gacctggccggcaagatcgcgcagatcgacggtcactggcaaccgcgcgttgtcgctgaa
atgaacgattatcagtttaaggtcgtaaaggtcaaaggcgagttccagtggcaccgacat
gccggtaccgacgaaacattcatcgtgctcgaaggcgagttgcgtatcgattttcgcgcg
gggccctccggcgacggttcgatcatgctgcgtgccggtcagatggcggtggtaccgaag
ggcgtcgagcacaagccccgtgcaagcgcagaagtgaagctgctgctgatcgagccgcga
ggcgtggtgaacacgggcgacggcgcgacgggcgagcgtaccgtcgagaacgaccagtgg
atttaa

DBGET integrated database retrieval system