KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5712Help
Entry
Reut_B5712        CDS       T00268                                 

Definition
(GenBank) Porin, Gram-negative type
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4 Porin_1
Motif
Other DBs
NCBI-ProteinID: AAZ65056
UniProt: Q46P78
Position
2:complement(2539710..2540846)
Genome map
AA seq 378 aa AA seqDB search
MKKKWLIALTTLGTVAGVAQAQSSVTLYGVLDTNVEVATNMKAPSGGSGTRYALNGGGLS
SSRWGLRGNEDLGGGLSGIFVLESGFSADDGKSLQGGRLFGRQAFVGLQNATFGKVTFGR
QYTSMLDALAPFSPAALAVLYEPVIALFGAAYRQDNTVKYTGTFGPLMVGAHWSFGIGPT
FSSPGGVNISGSGEVPGQIRRDSGFGGQTTYRAGSFGATLSYDQVNPSITRNGALLDIAT
SKKAAAAASYALGPIQIMGGYRWGKAVASGQTLVRDDLYWAGVSYEAARSLSLTLDYYYQ
AFHSSTTPALKPPGNPWQVAFIVDYNLSKRTDLYWTTVYAKNSGLCLDTASIGYANGYQP
GGTRNNMLGAAVGLRHKF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaatggctgatcgcgctaaccacacttggcaccgtagcaggcgtagcccaa
gctcagtccagcgtcacgttgtacggcgtgctggacacgaacgtcgaagtcgccacgaat
atgaaggcgccgagcggtggctcgggtacccgctacgcgctgaatggcggcggcctgtcc
agttcgcgctgggggctgcgtgggaacgaagacctgggcggcggtctgagcggtatcttt
gttctggaaagcggcttcagcgcggacgacggcaaatctctgcaaggcggtcgtctgttc
ggccgtcaggcattcgtcggcctgcagaacgcaacctttggcaaggtcaccttcggccgc
cagtacacgtcgatgctggatgcattggcccccttttcgcccgctgcgctggcagtcttg
tatgagccagtcatcgccctgtttggcgccgcctaccggcaagacaatacggtcaagtac
accggaacatttgggccgcttatggtaggtgcccactggtcattcggtattgggcccacc
ttcagcagcccgggcggcgtcaacatcagtggcagcggggaggttccgggccagattcgc
cgcgatagcggcttcggtggccagacaacttatcgtgcgggctcgttcggcgccacgttg
tcctatgatcaggtcaatccgagcattacccgtaacggtgcgctccttgatatcgccacc
agcaaaaaggctgccgccgcggccagctacgcccttggccctatccaaatcatgggcggc
tatcgttggggcaaagcagtcgcgtccgggcagacgctggtgcgtgacgacttgtattgg
gcaggggtttcctatgaggcggcacgttctctcagcttgacgctggattactactaccaa
gctttccactcttcgacaacgcccgcattgaagccgccaggcaacccttggcaagtcgcg
ttcatcgtcgactataacttgtccaagcgtacggacctatactggaccacggtgtacgcc
aagaattccggcctgtgcctggataccgcctccattggttacgctaatgggtatcagccg
ggaggcaccaggaacaatatgttgggggctgctgtgggcctccgccataagttctga

DBGET integrated database retrieval system