KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5713Help
Entry
Reut_B5713        CDS       T00268                                 

Definition
(GenBank) Phytanoyl-CoA dioxygenase
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhyH AraC_binding
Motif
Other DBs
NCBI-ProteinID: AAZ65057
UniProt: Q46P77
Position
2:2541484..2542329
Genome map
AA seq 281 aa AA seqDB search
MLTTPEMREQFRNDGVTIFRNCLNEAQLAQCYDGFKWDMANPGPHVYKGGLIGTTLHTHI
DIANPEAKSELDDLAAALPFGQIFQELWDSKNVWYFAEEIFAKEGGKSGRGPWHQDTANL
PWAGRHWGNAWISFQKLPKKNSLEIVRGSHLGIQYDGASFDSAEDPTDPLYGDGTYPRLP
HIDNELARDPNSWDIVSFDINPGDIVLLHPRSLHGGAQVDADCPTRHTLVLRFFGDDATF
RELPTCNPKYARNGPLFQKEMAKLNQGDAFRSPVFRQVAGV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccacccccgagatgcgcgagcagttccgcaacgacggtgtcactatcttcagg
aactgcctcaacgaagcgcaactggcccagtgctacgacggcttcaagtgggacatggct
aaccccggcccgcacgtctacaagggcggtctcatcggcaccacgttgcacacccacatc
gacattgctaaccccgaagccaagtccgagctggatgacctggcggccgcattgcctttc
ggccagatcttccaggaattgtgggactcgaaaaacgtctggtacttcgctgaggagatc
ttcgccaaggaagggggaaaaagcggccgaggcccctggcaccaggacacagcgaacctg
ccgtgggccggccgccattggggcaatgcctggatcagtttccagaagctgcccaagaag
aattcgctggagatcgtgcgcggttcacatctgggtatccagtacgacggcgctagcttt
gatagtgccgaggatccgaccgatccgctctatggcgatggcacctatcctcgtctcccg
cacatcgacaacgagcttgctcgggatcccaattcctgggacatcgtctcctttgacatc
aatcctggcgacatcgtcttgctgcacccgcgctctctgcatggcggtgcacaggtcgat
gccgactgcccgacccgccacacactggtgctgcgcttcttcggtgacgacgccaccttt
cgcgagttgcccacctgcaaccccaagtacgcccgcaacggcccgctcttccagaaagaa
atggccaagctcaatcagggcgatgcgttccgctcgccggtcttccgccaggttgccggg
gtctga

DBGET integrated database retrieval system