KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5714Help
Entry
Reut_B5714        CDS       T00268                                 

Definition
(GenBank) Endoribonuclease L-PSP
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: AAZ65058
UniProt: Q46P76
Position
2:2542365..2542763
Genome map
AA seq 132 aa AA seqDB search
MINPAPFKERHYDQLHFSSATRVGDMIWVSGQVGLDVATGKPGEGMAEQARLAFNNLKCV
LEEAGATMADIVEIVTFHIDLHGPDIQAFVRAKDEFLPERYPSWTAVGVTQLANPAFLVE
VRAVAVAGCGAD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccccgcgccattcaaggagcggcattacgaccaactgcatttctcgtccgcc
acccgtgtcggcgacatgatctgggtgtcgggtcaggtgggccttgatgtggccactggc
aagccgggcgagggcatggccgagcaggctcgactggccttcaacaacctgaagtgcgtg
ctggaggaggcgggtgcgacgatggcggacatcgtcgagatcgtgactttccacatcgac
ctgcatggcccggacattcaagcgttcgtgagggcgaaggacgagttcctgcctgagcgc
tacccctcctggactgcggtaggcgtgacccaactggcgaatccggcgtttcttgtcgaa
gttcgcgccgtcgcggtggccggctgcggtgccgattga

DBGET integrated database retrieval system