KEGG   Ralstonia eutropha JMP134: Reut_B5715Help
Entry
Reut_B5715        CDS       T00268                                 

Definition
(GenBank) Phytanoyl-CoA dioxygenase
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhyH
Motif
Other DBs
NCBI-ProteinID: AAZ65059
UniProt: Q46P75
Position
2:2542778..2543608
Genome map
AA seq 276 aa AA seqDB search
MQVTEQMKLDLARDGAFVARGLFSPEGLKRMREAFDYGIEHPSPQHGYIFKGTPDEHFND
YGNIANRDVHIATIKALVLDEFVASLWDSQHVWFKGEEIFIKKGGKAGRSPWHQDNSYTP
VSGPQMLNIWTCFERIPRKNALEVVRGSHLGIQYNGNSYTDPGKPTKPLWLNTDWPDLPD
IEAERAKDPNSWDVLSWDLELGDALVFHSGALHGGAPVSADCPDRHTLVYRFFGDKLFYR
PLPTGGCNYPYDISALNDPSLMPGEPFRAAWCTQLR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgactgaacaaatgaagctggacctggcacgggacggcgccttcgttgcacga
ggcttgttttctcctgaagggctcaagcggatgcgcgaggctttcgattatgggattgaa
cacccgagtccgcagcacggctacatcttcaaaggcacgccggacgagcatttcaacgac
tacggcaacattgccaaccgcgatgtgcatatcgcgacgatcaaggcactggtgcttgat
gaattcgtggcgtcgctatgggactcccagcatgtatggttcaaaggcgaggagatcttc
ataaaaaagggcgggaaggccgggcgatcgccgtggcatcaggacaactcgtacacacca
gtaagcgggccgcagatgctcaacatctggacctgttttgaacggatacctcgcaagaac
gcgctcgaagtcgtgcgcggctcgcatctcggcattcagtacaacggcaactcttataca
gacccgggaaagcccactaagccgttgtggctcaacaccgactggccggatcttccggat
atcgaggcggaacgggcgaaagatccgaactcgtgggatgttctttcatgggacctggaa
ttgggcgacgcattggtattccactccggtgcgctgcacggcggcgcccccgtcagcgcg
gactgccccgatcgccacacactcgtctaccggttcttcggcgacaagctcttctaccgg
ccgctgccgaccgggggctgcaactacccctacgacatcagcgcgctcaatgatccctcg
ctgatgccaggtgagccgtttcgcgccgcatggtgcacacaactgcgttga

DBGET integrated database retrieval system