KEGG   Ralstonia eutropha JMP134: Reut_B5716Help
Entry
Reut_B5716        CDS       T00268                                 

Definition
(GenBank) General substrate transporter:Major facilitator superfamily MFS_1
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2 TRI12 MFS_4 MFS_1_like Peptidase_U4
Motif
Other DBs
NCBI-ProteinID: AAZ65060
UniProt: Q46P74
Position
2:2543724..2545172
Genome map
AA seq 482 aa AA seqDB search
MSHIDGTKSFSDSNSRSSHLLARFDRLPTMSTHYAWAALLAINLMLEYYDNAIFSYAAPT
IKAHTGMSTEQIGVISSALYVGMVIGALAGGWLSDRVGRRPVLVWGTVMYSLGVIVTAFV
PGYEMILTSRFVTGLGVQAATSVLLVYVAEMFPRHARGRFLSLVTMGYTASAVIAAALAM
FYLPTGGPNTWRYLFLAGGIGLLIAPLVYFYLPESVRWCVSRGKLEHAAQIVASLEARAL
RKGPLDDPNPLAAQGGAANATLRDLLRNKGVLRNLIVLFVSYFGVYLAYYTWINWSIYAL
VYGLKYPQKDAYFIMFIWVVVYGVMPFIAMRLLDRWERKNTILCMSVFCALALVVLGLST
SYWAVAVIGGALAIFSGFVLNAYYTYIPETMPTQLRALGNGIVMSGARVGGVVSGVMGAA
LVTAGGLKYVTWTAAAIYIAFAIPVLIFGPRTTNRSLEAVADEELGLGTSCDPTKSAAHA
AA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcacatcgacggaacgaagtcattctcagacagtaactcccgctcctcccatctg
ttggcgcggttcgaccgcttgccaaccatgagcacgcattacgcctgggcggcattgctg
gcaatcaacttgatgctggagtattacgacaacgccatcttttcgtacgctgcgccgacc
atcaaggcgcacacgggcatgagtaccgagcagatcggggttatcagcagcgccctctac
gtggggatggtgattggcgcgctggccggcggttggctctccgacagggtggggcgtcgt
ccagtgctggtgtggggcacggtcatgtactcgctcggcgtgatcgtgacggcgttcgtc
ccagggtacgagatgatcctgacctcccgcttcgtgactggactgggcgtgcaggcggcc
acgtcggtgctgctcgtctacgtcgccgagatgttcccacgccatgcacgcggacgtttt
ctctcgctcgtgacgatgggctacacagcctcggcagtgattgcggcggcattggccatg
ttttacctgcctacgggcggaccgaacacctggcggtacctgttcttggccggcggcatc
ggcttgctgattgcgcccctcgtgtatttttatctgccggagtcagtgcgctggtgcgtc
tctcgcgggaagctcgagcacgcagcgcagattgtcgccagcctggaagcgcgcgcgttg
cgcaaggggccgctcgacgaccccaatccgctggcagcgcaaggcggcgcagcgaatgcc
accttgcgggacctgctgcggaacaagggggtcttgcgcaacctgatcgttctgtttgtg
tcctatttcggggtgtacctggcgtactacacttggatcaactggagcatctacgcgctg
gtgtatggtctcaaatacccccagaaggacgcgtatttcatcatgttcatctgggtcgtg
gtctacggtgtaatgcctttcattgccatgcgactgctggatcggtgggaacgcaagaac
accatcctctgcatgtcggtgttctgcgcgctcgcgttggttgtgctgggcctttcaacc
agctattgggccgtggccgttatcggcggggcgctcgccatcttcagtggcttcgtactc
aacgcctactacacatatatccccgagacaatgccaacgcagttgcgtgccttgggcaat
ggcatcgtgatgtcgggtgcgcgggtcggcggcgtggtgtccggcgtgatgggcgcggcg
ctggtcactgcgggtggcctgaagtacgtaacgtggaccgccgccgccatctacatcgcc
ttcgccatccccgtgcttatcttcggcccgcgcaccaccaaccgttcgctggaagcagta
gccgacgaagaattgggccttgggacgtcatgcgaccccaccaagtcagccgcgcacgct
gccgcatga

DBGET integrated database retrieval system