KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5720Help
Entry
Reut_B5720        CDS       T00268                                 

Definition
(GenBank) NAD(P)(+) transhydrogenase (AB-specific)
  KO
K00324  NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00760  Nicotinate and nicotinamide metabolism
reu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Reut_B5720
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     Reut_B5720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAZ65064
UniProt: Q46P70
Position
2:2549630..2550748
Genome map
AA seq 372 aa AA seqDB search
MNIGVPVETHACESRVAATPETVKKYVAQGHKVVVQAGAGLRASQPDSAYEAAGATIGTA
ADALGAPLVLKVRAPETAELAQMKSGAVLVGMLNPFDTENNARMTAAGITAFALEAAPRT
TRAQSMDVLSSQANIAGYKAVLVAAHHYQRFMPMLMTAAGTVKAARVLILGAGVAGLQAI
ATAKRLGAVIEASDVRPAVKEQIESLGGKFLDVPFVTDEEREIAQGVGGYARPMPPDWMR
RQAELVHERAKQADIIITTALIPGRKAPVLLHEATVQQMKPGSVVVDLAAAQGGNCPLTV
ADEVVERHGVIFVGHTNLASMVAADASALYARNVLDFLKLVIDKDGQFSLNLEDDIVAAC
LMTRREEAALAG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcggagtgcccgtagaaacgcatgcgtgcgaatcacgcgtcgccgctacgccg
gagacagtcaagaagtacgtcgcacaaggccacaaggtcgtggtgcaggcgggcgcgggc
ttgcgtgccagccagcccgatagcgcctatgaggcggccggtgcgacgatcggcaccgcc
gccgacgcgctcggcgcgccgctcgtgctcaaggtgcgcgcacctgagaccgccgaactg
gcgcagatgaagtccggcgccgtgctggtgggcatgctcaacccgttcgataccgagaac
aacgcgcgcatgaccgccgccggcatcaccgccttcgcgctcgaagcggcaccgcgcacc
acgcgtgcgcagagcatggacgtgctgtcctcgcaggcgaacatcgccggctacaaggcc
gtgctggtcgcagcgcatcactaccagcgcttcatgccgatgctgatgaccgccgcgggc
accgtcaaggccgcgcgcgtgctgatcctcggtgccggcgtggcgggcttgcaggccatc
gccacggccaagcgcctcggtgcggtaatcgaagcgtcagacgtgcgcccggcggtgaag
gagcagatcgaatcgctcggcggcaagttcctcgacgtgccgttcgtcaccgacgaagag
cgcgagattgcgcagggcgtgggcggctatgcgcgcccgatgccgcctgactggatgcgc
cgccaggccgaactggtccacgagcgcgccaagcaggccgacatcatcatcaccaccgcg
ctgatccccggccgcaaggcaccggttctgctgcacgaagccaccgtgcagcagatgaag
ccgggctcggtggtggtcgaccttgccgccgcgcaaggcggcaactgcccgctgacggtg
gccgacgaagtggtcgagcgccatggcgtgatcttcgtgggccatacgaacctggccagc
atggtcgcggcagacgcctcggcgctgtacgcgcgcaacgtgctggacttcctcaagctg
gtcatcgacaaggacggccagttctcgctcaacctcgaagacgacatcgtcgcggcttgc
ctgatgacgcggcgcgaagaagcggcgctggccggttaa

DBGET integrated database retrieval system