KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5724Help
Entry
Reut_B5724        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve HTH_21
Motif
Other DBs
NCBI-ProteinID: AAZ65068
UniProt: Q46P66
Position
2:complement(2554173..2554649)
Genome map
AA seq 158 aa AA seqDB search
MPAFGNGILGHDLFQRFACGRLLAGLELIIGNRDHGVRHLKRVARLMREAGLRGVSRRRW
VKTTRRAPGARPAPDLVQRHFQADAPNRLWVADATYIPTAAGFFYLAVVLDVFSRRIVGW
AMGSHLRTELMLQALDMALAQRNSFFKTVSHPVTVSVL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccttcggtaacgggatacttggccacgacctgttccagcgttttgcgtgcggc
cgccttctggccggactcgagctgattattggcaaccgcgatcatggcgtccggcacctc
aagcgcgtggctcgcctgatgcgtgaagcgggcctgcgcggcgtaagccggcgccgctgg
gtaaagaccacgcggcgagcacctggcgcacgaccggctccggatctggtgcagcgccac
ttccaagctgacgcaccgaaccgtctgtgggtcgccgatgcgacctacattccaaccgca
gcgggcttcttctacctcgcggtggtgttggatgtgttcagccgccggattgttggctgg
gccatgggcagccatctgcgtaccgagttgatgctgcaggcgctggatatggcgctcgca
cagcgcaacagcttcttcaagaccgtctcacatccagtgaccgtaagcgtgctatag

DBGET integrated database retrieval system