KEGG   Ralstonia eutropha JMP134: Reut_B5727Help
Entry
Reut_B5727        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65071
UniProt: Q46P63
Position
2:2557679..2557882
Genome map
AA seq 67 aa AA seqDB search
MGIESYQDYTVRGFAKQMGDGSFEAFGTVQKDHLVLEASEPLGYYPTFDLAVAAGIAWAK
AWVEDQR
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgagagctaccaggactacacagttcgtggctttgcgaagcaaatgggcgat
ggttcgttcgaagcctttggcaccgtgcaaaaggaccatctcgttctggaggcgtctgag
cctttgggctactacccaacgttcgaccttgccgtcgcggcaggcatcgcatgggcgaaa
gcgtgggtcgaggatcaacgctga

DBGET integrated database retrieval system