KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5734Help
Entry
Reut_B5734        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65078
UniProt: Q46P56
Position
2:2562973..2563329
Genome map
AA seq 118 aa AA seqDB search
MGRLVDYLRAYVIYRRSAKAADLLWKYYGLRITDEIHHRLMCLSVQARGELAPQALAMLY
LAAMLEEYEGDPHAPIVHASVEFLLRRAIAANARGRRRDSIHFQHLREIAMRKYGWEP
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggttggttgactaccttcgcgcgtatgtcatctaccgtcgaagcgcgaaagca
gcagacctcctctggaaatactatggtctccggatcacagacgagatccaccaccggctg
atgtgcctcagcgttcaggcccgaggcgaactcgcgccacaggcgctggcgatgctctac
ctcgccgcgatgctagaggaatacgaaggcgacccccacgccccgatcgtccacgcaagc
gttgagtttctcctgcgtcgtgccatcgcggccaatgccaggggccggcggcgcgactcc
atccactttcagcatctacgggagatcgctatgcgaaaatacggctgggagccataa

DBGET integrated database retrieval system