KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5741Help
Entry
Reut_B5741        CDS       T00268                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00740  Riboflavin metabolism
reu00790  Folate biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Reut_B5741
   00790 Folate biosynthesis
    Reut_B5741
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Reut_B5741
Enzymes [BR:reu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Reut_B5741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65084
UniProt: Q46P50
Position
2:complement(2566551..2566820)
Genome map
AA seq 89 aa AA seqDB search
MSQNNSIYKGFRLSASVRRASSGIPGGDSVQPRFLATVTIMQVCSGMGSRRQLPPLLQHF
ANAPHAAITLALSSARDAIDGLSTFVKAR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaacaacagcatctacaaaggcttcaggctatctgcgagcgtacgtcgtgcc
tccagtggcatccccggtggcgactcggttcagccgcgcttcctcgctaccgtaaccatc
atgcaagtctgttcaggaatgggttcccgaagacagctgccaccgttgctccagcatttc
gcaaacgcgccgcacgctgcgatcacgctggccctctcgtccgccagggacgcgatcgat
ggcctgtctaccttcgtcaaggcgaggtaa

DBGET integrated database retrieval system