KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5747Help
Entry
Reut_B5747        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65090
UniProt: Q46P44
Position
2:2570166..2570489
Genome map
AA seq 107 aa AA seqDB search
MPAWQAMKEDIVPKESAETTYRFIHVTRLLRDRQVGRPSKGNTQRFGVMRLAASQWHQAI
TLLIDWDRAVNEGWPDLRSPSCTRTRAMRSIGRSHQASNRRLAGNGH
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
gtgccagcgtggcaagcgatgaaggaagatatcgtgccgaaagaatctgcagagaccact
taccggtttatacatgtcacgcgccttttacgcgaccgccaggtgggcaggccgtcgaag
ggaaatacccagcgattcggagtcatgcgattggcagcgtcccagtggcatcaggcaatc
acgctgctgattgactgggatcgtgctgtcaacgaaggctggccagacctgcggtcaccg
tcctgcacccgaaccagagccatgaggagcatcggccgtagtcatcaagcaagcaaccgc
cggctcgccggaaatgggcactga

DBGET integrated database retrieval system