KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5750Help
Entry
Reut_B5750        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5429
Motif
Other DBs
NCBI-ProteinID: AAZ65093
UniProt: Q46P41
Position
2:2571478..2571747
Genome map
AA seq 89 aa AA seqDB search
MSQNNAIYKGFRVSARVRHAPGAVPGGDRVQSRFLATVTITQVSTGMGSRRRLPAVIQHF
ASAPHAATALALSSARDAIDGMSTFVKAR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaacaacgcaatctacaaaggtttcagggtatctgcgagggtgcgtcacgca
cccggtgcagtccccggcggggaccgggttcagtcgcgcttcctcgctaccgtaacgatt
acacaagtgagtacaggaatgggttcgcgcagacggctgccagccgtgatccagcatttc
gccagtgcgccgcacgctgccaccgcgctggccttgtcgtcggccagggatgcgattgac
ggcatgtccaccttcgtcaaggcgaggtga

DBGET integrated database retrieval system