KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5755Help
Entry
Reut_B5755        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3311 DUF106
Motif
Other DBs
NCBI-ProteinID: AAZ65098
UniProt: Q46P36
Position
2:2575170..2575463
Genome map
AA seq 97 aa AA seqDB search
MRTKKGRRRTPDSRLNIEMETDMLKLFIGLGIPYIGVIGMLPWVASVERFVLGVPFIYAW
IFLWFVLTSGCMLACWWLFDRRADSLDTEVVPAADPC
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccaagaaaggacggcgccggactcccgacagccgcctcaacatcgaaatggag
acagacatgctcaagctgttcataggcttgggaatcccgtacatcggcgtgatcggcatg
ctgccgtgggtagcgtcggtcgagcgcttcgtgctcggggtgcccttcatctatgcgtgg
attttcctgtggtttgtgctgacgtcgggctgcatgctcgcgtgctggtggttgttcgac
cgacgcgccgattcgcttgacaccgaggtcgtgcccgcggccgacccctgctga

DBGET integrated database retrieval system