KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5764Help
Entry
Reut_B5764        CDS       T00268                                 

Definition
(GenBank) Sulfatase
  KO
K01133  choline-sulfatase [EC:3.1.6.6]
Organism
reu  Cupriavidus pinatubonensis JMP134
Brite
KEGG Orthology (KO) [BR:reu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Reut_B5764
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.6  choline-sulfatase
     Reut_B5764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase Phosphodiest DUF4976 Sulfatase_C
Motif
Other DBs
NCBI-ProteinID: AAZ65107
UniProt: Q46P27
Position
2:2587911..2589359
Genome map
AA seq 482 aa AA seqDB search
MASKNVVVIMSDEHDPRMMGCSGHPFVKTPNLDALAARGVRFSSAYTPSPICVPARAAFA
TGRRVHQVRLWDNAMPYTGEQRGWGHVLQDRGIRVESIGKLHYRNEEDPAGFDAEHLPMH
VVGGHGMVWASIRNPFRPRENGPRMLGEHIGPGESSYTQYDRAVTQRAVQWLQEAAQRQE
AGFVLYVGLVAPHFPFVVPEEFYSLYPTDGLPEPKLHPRTGYEQHPWVREYCDFMASERQ
FADADERLRAFAAYYGLCTWLDHNVGQILGALRDNGLEDTTHIVYTSDHGDNLGARGVWG
KSTLYEESVKVPMLLAGPIVTPGVCNTPVDLLDLFPTILQGAGVDPATEIDERPGRSLFE
LARSAPEPDRVILSEYHAAGSNAGGFMLRKGRWKYHHYVGFRPELFDLESDPEELTDLAG
DPAYAPVLASMHEALLAICDPDAVDRQAKCDQAALIEHYGGPDMAHTLGSSTSTPVTAKT
AA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaagaatgttgtggtcatcatgtccgatgagcacgacccgagaatgatgggc
tgctccgggcatcccttcgtgaaaactcccaacctggatgcactggccgcccgcggcgtg
cgcttctccagcgcctacacacccagcccgatctgcgtcccggcccgtgcagcctttgcc
accggccggcgggtacatcaggtccggctttgggacaacgccatgccgtatacgggcgag
cagcgcggctggggccatgtgctgcaggaccggggcatccgcgtcgaaagtatcggcaag
ctgcattaccgcaatgaagaagatccggcgggcttcgatgcggagcacctgccgatgcac
gtggtcggtggccacggcatggtctgggcgtcgatccgcaatccgtttcgtccacgcgaa
aacggcccgcgtatgctgggcgagcacatcggccccggcgagtcgtcgtacacgcaatac
gaccgggcggtaacgcaacgggcggtgcaatggctgcaggaggcggcacagcgccaggaa
gccggctttgtgctgtacgtcggcctggtcgcgccgcatttccccttcgtcgtacctgaa
gagttttacagcctctacccgaccgacggcctgccggagccgaagctgcacccgcgtacc
ggctacgaacagcatccctgggtcagggagtattgcgacttcatggcgtcggaacggcag
ttcgccgatgctgacgaacgcctgcgcgccttcgccgcgtactacgggctctgcacctgg
ctcgaccacaacgtcggccagatcctcggggcgctgcgcgacaacggattggaagacacc
acgcacatcgtctacacctccgaccacggggacaacctcggcgcgcgtggtgtctggggc
aagtcgaccctctatgaagagagcgtcaaggtgccgatgctgctggccggcccgattgtc
acgcccggtgtgtgcaacacccctgtcgacctgctggacctgttcccgacgatcctgcaa
ggcgcgggtgtcgatccggcgacggagatcgatgaacggcccggccgctccctgttcgag
cttgcgcgctcggcgccggaaccggatcgggtcatcctcagcgagtaccacgcggcaggc
agcaatgcgggtggcttcatgctgcgcaagggacgctggaagtaccaccattacgttggc
ttccgcccggagttgttcgacctggagtcagaccccgaggaactgaccgatctggctggc
gatccggcatacgccccggtccttgccagcatgcacgaggccctgctggcgatctgcgac
cccgatgcagttgatcggcaggccaagtgtgatcaagccgccctgatcgagcactacggc
ggccccgatatggcccatacgctcggctcgtccacatccacgcccgtgacggcaaagacc
gctgcataa

DBGET integrated database retrieval system