KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5767Help
Entry
Reut_B5767        CDS       T00268                                 

Definition
(GenBank) General substrate transporter:Major facilitator superfamily MFS_1
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AAZ65110
UniProt: Q46P24
Position
2:2591905..2593221
Genome map
AA seq 438 aa AA seqDB search
MTSIDLALQAHHPMLRQKWKTVILASLGGSLELYDFIIYGVFAREIATQFFPATDPVASL
IGAFGVFALGYMSRPLGGVILSSLGDRLGRRVVFLVSVLAMSATTIGIGLVPGYAAIGMA
APVLLVMLRLLQGFFLAGELPCSITYVVEEVPGRASTVSGLVIFCAAAGILIATLVSLVI
HSTLSADDVLTYGWRIAFLFGGVIGLLSYWLRTSLEESSEFQQLRSHKVKRPFRRVLAEY
PKQIVVGVGVAGIVNASNSLLFVVLPSYMALVLHADPRLVSEGQNIGIATMCVSLLLFAC
LGDRIASRHWHRLGTILMLAGSYPFYALLTAQRLDVIAAFTIIGAIGGLVNGSYAFLLAD
LFPTEVRFSGIALSLNLATVIFTGATPFLVTQLLHATGSPAAPGLYLTGVAVIALAAGIG
LKAMGGRIDRAGTIAGAA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatcgacctcgcgttgcaagcgcaccatcccatgctcaggcagaagtggaaa
accgttatcctggcgagccttggcggttcgctggaactgtacgacttcatcatctacggc
gtcttcgcgcgggagatcgccacgcaattctttcccgcgacagatcccgtcgcttcgctg
attggcgccttcggcgtcttcgcgctcggatacatgtcccggccgctgggcggtgtcatc
ctgagcagcctgggcgaccgattgggccggcgcgtggtcttcctggtctcggtgctggcg
atgtcggccacgaccatcggcattggcctggtccccggctatgcggccattggcatggcc
gcaccggtgttgctcgtgatgctccgcctcctgcaaggattcttcctggcgggggaattg
ccctgctcgatcacgtatgtggtagaggaggtacccggccgcgcgagcacggtcagtggg
cttgtcattttctgtgccgctgcgggtatcctgatcgcgacgctcgtcagcctggtcatt
cattcaacactgtcggcggatgatgtcctgacatacgggtggcgcattgccttccttttt
ggcggcgtcatcggcctcttgtcgtactggctgaggacctcgctcgaggagtccagcgag
ttccagcaactcagaagccacaaagtcaagcgccccttccgccgtgtgctcgctgaatat
ccgaagcaaatcgttgttggcgtgggagtggctgggatcgttaacgcgtcgaatagcttg
ttgttcgtggtgctgccgtcgtacatggcgcttgtactgcatgcggatccgcgtcttgtc
agcgaggggcagaacatcgggattgccacgatgtgcgtgtcgctgcttctctttgcctgc
ctgggtgaccgcatagcgtctcgacactggcatcggctcgggacaatcctgatgctggca
ggaagctacccattctatgcactgctcaccgcccagaggctcgacgtgatcgcggccttc
acgatcattggggccataggcggactggtgaatgggtcctacgccttcctgttggcggat
cttttccccactgaagtccgcttcagtggcattgcgctttcgcttaaccttgccacggtc
atattcacgggcgccacgcccttcctggtgacacaactcctgcacgcgacgggatctccg
gctgcgcctggcctctacctgacgggtgtcgccgttattgcactggctgccggcatcggg
ctgaaggctatggggggcagaatcgatcgcgccggtacgatcgcgggcgcagcttga

DBGET integrated database retrieval system