KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5782Help
Entry
Reut_B5782        CDS       T00268                                 

Definition
(GenBank) L-fuconolactonase
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2 E1-N
Motif
Other DBs
NCBI-ProteinID: AAZ65125
UniProt: Q46P09
Position
2:2606575..2607372
Genome map
AA seq 265 aa AA seqDB search
MLIDSHAHVSPVWYEPVETLLCQMKRHDVARAVLTQMIGQADNRYQADCVRAHPGRFASV
VWIDPAAPDAPRALARLADEGAAGVRLRPGARSPGDDPLAIWRAAEACGLPVSCVGNAEA
FTTPAFADLLQAVPGLTVVLEHLGDTSKPMQTVADGELRYTVLRLARFNNVCLKVPGLGE
LAPRAPGALRDGPTFGGEAAALLEAAIAAFGAQRLMWGSDFPVVSSREGYGNALALVREC
LLDHPAVVREAILGDTARRIFWKEI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgatagccacgcgcatgtctcgccggtctggtacgagccggtggagacgctg
ctctgccagatgaagcgtcacgacgtggcgcgtgcggtgctgacgcagatgatcgggcag
gcggacaaccgctaccaggcggattgcgtacgcgcgcatccaggccgattcgccagcgtg
gtctggattgacccggccgcgccggacgctccgcgcgcgcttgcaaggctggcggacgaa
ggtgccgccggcgtgcgcctgcgcccgggagcccgctcgcccggcgacgatccgctggcg
atctggcgggccgcagaagcttgcggcctgccggtcagttgcgtcggcaatgccgaagcg
tttaccacgccagcctttgccgatctgctgcaggcggtgccgggcctgacggtcgtgctg
gagcatctcggcgacaccagcaagccgatgcagaccgtggccgatggcgaattgcgctac
acggtgctgcggctggcccgcttcaacaatgtgtgcctcaaggttcccggcctcggggaa
ctggcgcctcgtgcgcccggcgcgctgcgggacggccccacgttcggcggtgaggcggca
gcgctgctggaggccgccattgcagcgttcggcgcgcagcgcctgatgtggggtagcgat
tttccggtggtgagcagccgtgaaggctatggcaatgccctggcgctagtgcgcgaatgc
ctcctcgaccatccggcagtggttcgcgaggccatccttggcgataccgcgcgccgtata
ttttggaaggagatttga

DBGET integrated database retrieval system