KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5790Help
Entry
Reut_B5790        CDS       T00268                                 

Definition
(GenBank) Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal:FAD dependent oxidoreductase
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO FAD_oxidored Pyr_redox_2 NAD_binding_8 HI0933_like PQQ_3 Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AAZ65133
UniProt: Q46P01
Position
2:2613685..2615256
Genome map
AA seq 523 aa AA seqDB search
MEQKTHAVNWSPPAWDDEADMVVVGYGGAGATFAFAAAEAGADVLVLEKGDRGGGNSVCV
AGGLIMTSSDEEATFDYMNWLCAGQTDEPVLRNFVTGLKDIPAFQHKLELPLKDNPRPFS
APGFFPEFPGAPGAASIHGMSVVAAPGGAGLYNAIAAVAEKHGARVQCNTTVTQLVQDPA
SRGILGVLARTAEGRTIAVKARKATVLASGGFEFDAEMCRQYLTPCPIHFLGSPNLTGDG
IRMAQEVGAQLWHMNAVAGPLNWGIRVDGGRVYVTYDLNKVAGFGYNSGAFKDGGSLIWV
NREAARFHNETTDTADVRHGLSNRATWLATNPDVPEFINVPAFHIFDEKVRSGGAAMTTL
NSRTPPWSQDNLAELEKGWILQADTLEELALKCRWDAEPGAWPAGHLDPEALKATVARYN
AQCAAGEDTDFGRKNFLVPLDKGPYYAIGPMLPTFLNTHGGPRHDARQRVLDQRGAPIPR
LYAIGECGSLWGPYYNSMGDIAEFIVSGRTAARAALEEDAWDR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagacgcatgcagtgaactggtcgccgccggcttgggacgacgaggccgac
atggtcgtggtcggctacggcggcgctggcgcaacgtttgccttcgcagccgcagaggcc
ggcgccgacgtgctggtgctggaaaagggcgatcgcggcggcggcaattcggtttgcgtc
gcgggcgggctcatcatgacctcgtccgacgaggaagccacgttcgactacatgaactgg
ctgtgcgccggccagaccgacgagccggtcctgcgcaactttgtcacaggcctgaaggac
atcccggccttccagcacaagctggagctgccgctgaaggacaaccccaggcccttcagc
gcgccgggattctttcctgagtttccgggcgcgccaggcgctgcgagcatccacggtatg
agcgtggtggccgcgcccggcggggcagggctatacaacgccatcgcggcggtagctgaa
aagcatggtgcgcgcgttcagtgcaatacgacggtgacgcagctcgtgcaggatccggcg
tcgcgaggcatcctgggcgtgctcgcccgcaccgctgaaggccgcaccatcgccgtgaag
gcacgcaaggcgacagtgcttgccagcgggggcttcgagttcgatgccgagatgtgccgg
cagtacctgacaccgtgcccgatccatttccttggcagcccgaacctgaccggcgacggc
atccgcatggcgcaggaggtcggtgcccagctctggcacatgaatgccgtggcagggccg
ttgaactggggcatcagggtggacggcggcagggtgtacgtgacgtacgacctcaacaag
gtagcgggcttcggctacaactcgggcgcgttcaaggacggcggcagcctgatctgggtg
aaccgtgaggcggcacgcttccacaacgagaccaccgatacggccgatgtccgccacggc
ctcagcaaccgcgccacctggctggccaccaaccccgatgtgcccgagttcatcaatgtg
cctgccttccacatcttcgacgagaaggtgcgctcgggcggcgcagccatgacgacgctg
aactcgcgcaccccgccgtggagccaggacaacctcgccgaactggagaagggctggatc
ctccaggcggacacgctggaggagctggcgctgaagtgccgctgggatgcggagcccggc
gcctggcccgccggccatctcgaccctgaagcgctgaaggccaccgtggcgcgctacaac
gcgcaatgcgcagccggcgaggacaccgacttcggccgcaagaatttcctcgtgccgctc
gataaaggtccgtactacgccatcggcccgatgctgccgaccttcctgaacacgcacggc
ggcccccgacacgacgcccgccagcgcgtgctcgaccagcgcggcgcgcccatcccacgg
ctgtacgccatcggcgaatgcggctcgctgtgggggccttactacaactcgatgggcgac
atcgcggagttcatcgtgtcgggccgcaccgccgcgcgcgcggccctggaagaagacgcc
tgggaccgctga

DBGET integrated database retrieval system