KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5795Help
Entry
Reut_B5795        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65138
UniProt: Q46NZ6
Position
2:2619223..2619411
Genome map
AA seq 62 aa AA seqDB search
MKKEMWIGVAMCVFLSVAACIGSTGLGYADYRPLRNFDYFALGVSWLFLIVTIIKDRRSN
KS
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagagatgtggattggcgtggccatgtgcgtgttcttgtccgtggcggcatgc
atcggctcgacagggctgggctatgcggactatcgcccgctgcgcaatttcgactatttc
gcgctgggagtgtcgtggctcttcctgatcgtgaccatcatcaaggatcgccgcagcaac
aaatcgtga

DBGET integrated database retrieval system