KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5798Help
Entry
Reut_B5798        CDS       T00268                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR FCD HTH_Crp_2 HTH_11 HTH_24 MarR_2 HTH_CodY FaeA HTH_41 HTH_36 DUF2721
Motif
Other DBs
NCBI-ProteinID: AAZ65141
UniProt: Q46NZ3
Position
2:2621587..2622291
Genome map
AA seq 234 aa AA seqDB search
MIAGVPSVHPLPNMNHVEVKGVDLPAQIAQQVRKLINRGTLAPGLQLRQSDLADRFGISR
VPVREALKLLAAEGIIEHDPNRGFFVAPLSTDEARQLYRYRFLLERELLKTVEWPDSTQM
KALKAMLERLDSYLDSGQRAEWIDEYQDFYALLFDLSPDKILRREAIRLIRLTDRYRALA
SEVRVPGEQRTAHLEHTLLAAMSKRDRAQLIRGFEREREKILASMLARIDARGL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaggcgtcccgtctgtccatccgctgccgaacatgaaccatgtagaagtcaag
ggcgtagatcttccggcccagatcgcccaacaggtccgcaagctgatcaatcgcggcacc
cttgccccggggctccagttgcgccagtcagacctggccgatcgcttcggcatcagccgg
gtgccggtgcgagaggcgctcaagctgctggcggccgagggcatcattgaacatgatcct
aaccgcggctttttcgttgctccgctttcgacagacgaagcccgccagctctaccgctac
cggttcctgctggagcgggagttgctgaagaccgtcgaatggccggacagcacgcagatg
aaggcactgaaggcgatgctggaacggctcgacagctacctcgatagcggccaacgcgca
gagtggatcgacgaataccaggatttctatgcactgctgtttgacctgtcaccggacaag
atcctgcggcgcgaggcgattcgcctgatcaggctgaccgaccgctaccgggcactggcc
tcggaggtgagggtaccgggcgaacaacggaccgcgcacctggaacatacgctgttggcc
gccatgtcgaaacgggaccgtgcgcaactcatccgcggtttcgaacgcgagcgcgagaag
attctggcgtcgatgctggcgaggatcgacgcgcgcgggctgtag

DBGET integrated database retrieval system