KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5804Help
Entry
Reut_B5804        CDS       T00268                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00350  Tyrosine metabolism
reu00643  Styrene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Reut_B5804
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    Reut_B5804
Enzymes [BR:reu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Reut_B5804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_C_5
Motif
Other DBs
NCBI-ProteinID: AAZ65147
UniProt: Q46NY7
Position
2:2627478..2628119
Genome map
AA seq 213 aa AA seqDB search
MQLYSFFNSSTSYRVRIALALKGLSYEYLPVNIRVGEHHDGDYVNAINPSASVPALIDGD
FALGQSLAIVDYLDARHPEPRLLPTSGHLRARVLELAYLVSCDMHPVNNLRILKYLQSEL
KVSPEQKDAWYRHWIDEGMAGVERLLSRYGEGPWCFGSQPTLADVCLVPQIANALRMGCD
LSGYPKAMAVYAHASAHPAFALAAPARQPDYTA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctacagttttttcaatagttccacgtcgtaccgcgtgcgcatcgccctcgcg
ctcaagggcctgtcgtacgagtacctgccggtgaacatccgcgtcggcgaacatcacgac
ggggattacgtgaacgcaatcaacccgtcggcatcggtaccggcgctgatcgatggcgac
ttcgcgctcgggcagtcgctggcgatcgtggattatctcgacgcgcgccatccggagccg
cgcctgctgccgacgagcggccatctccgcgcgcgggtgctcgaactggcatatctggtg
agctgcgacatgcacccggtgaacaacctgcgcatcctcaagtatctgcaaagcgagctg
aaggtgtctcccgagcagaaggacgcgtggtatcgccactggatcgatgaaggcatggcc
ggcgtcgagcgcctgctttcccggtatggggaagggccgtggtgcttcggctcccagccc
acgctggcagacgtttgcctcgtgccgcagatcgccaatgccttacgcatgggctgcgat
ctttccggttacccgaaggcgatggcagtgtatgcccacgccagcgcgcaccccgctttc
gccctggccgccccggcgcggcagcccgactacaccgcctga

DBGET integrated database retrieval system