KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5823Help
Entry
Reut_B5823        CDS       T00268                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00360  Phenylalanine metabolism
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Reut_B5823
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5823
   00622 Xylene degradation
    Reut_B5823
   00621 Dioxin degradation
    Reut_B5823
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Reut_B5823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AAZ65166
UniProt: Q46NW8
Position
2:complement(2651465..2652487)
Genome map
AA seq 340 aa AA seqDB search
MPFNPGKKLYISDVTLRDGSHAIRHQYSIQNVKDIARALDKARVDSIEVAHGDGLQGSSF
NYGFGAHTDLEWIEAVAGEISHAQIATLLLPGIGTIHDLDNAYKAGARIVRVATHCTEAD
VSRQHIERARELGMDTVGFLMMSHMTTPENLAVEAKKMESYGATTIYVVDSGGALSMDDV
RARFRALKAVLDPSTTTGMHAHHNLSLGVANSIVAVEEGCDRIDASLAGMGAGAGNAPLE
VFIAAADRMGWDHGTDLYTLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEV
AANKYGIKTVDILVELGKRRMVGGQEDMIVDVALDLLNKA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcaaccccggcaagaagctctacatttccgacgtgacgctgcgtgacggcagc
cacgccatccgccaccagtattcgattcagaacgtcaaggacatcgcccgcgcgctcgac
aaggcccgcgtcgattccatcgaagtcgcccacggagacggcctgcagggctccagcttc
aactacggcttcggcgcccacaccgacctggagtggatcgaggccgtggccggcgagatc
tcgcacgcgcagatcgccacgctgctgctgcccggcatcggcaccatccatgacctggac
aacgcctacaaggccggcgcgcgcatcgtgcgcgtggccacgcactgcaccgaggccgac
gtctcgcgccagcacatcgagcgtgcgcgcgaactgggcatggatacggtcggcttcctg
atgatgagccacatgacgacgccggaaaacctggcggtcgaggcgaagaagatggaaagc
tacggcgcgaccacgatctacgtggtcgattccggcggcgcgctcagcatggatgatgtc
cgggcccgcttccgcgcgctcaaggccgtgctcgacccgtcgaccacgacgggtatgcac
gcccaccacaatttgtcgctcggcgtggccaattcgatcgtcgccgtcgaagaaggctgc
gaccgcatcgacgccagcctcgccggcatgggcgccggcgccggcaatgcgccgctggaa
gtcttcatcgccgccgccgaccgcatgggctgggaccacggcaccgatctgtacacgctg
atggacgccgccgatgacatcgtccgtccgctgcaggaccgcccggtgcgcgtcgaccgc
gagaccttggcactaggctacgcaggcgtgtattcgagcttcctgcgccactccgaagtc
gccgccaacaagtacggcatcaagaccgtcgacatcctggtcgagcttggcaagcgccgc
atggtcggcggccaggaagacatgattgtcgacgtggcgctggacctgctcaacaaggca
taa

DBGET integrated database retrieval system