KEGG   Cupriavidus pinatubonensis JMP134: Reut_C5943Help
Entry
Reut_C5943        CDS       T00268                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00072  Synthesis and degradation of ketone bodies
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00640  Propanoate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_C5943
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_C5943
   00640 Propanoate metabolism
    Reut_C5943
   00650 Butanoate metabolism
    Reut_C5943
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_C5943
   00072 Synthesis and degradation of ketone bodies
    Reut_C5943
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_C5943
   00310 Lysine degradation
    Reut_C5943
   00380 Tryptophan metabolism
    Reut_C5943
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_C5943
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_C5943
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_C5943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_C5943
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_C5943
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_C5943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAZ65284
UniProt: Q46NI0
Position
mega:59864..61066
Genome map
AA seq 400 aa AA seqDB search
MLNSNIDPIVILSAARTPMGGFQGELSPLTAPELGGAAIRAAVERANVNETSIQELLMGC
VLPAGVGQAPARQAGIHGGLSLSVPCTTISKVCGSGMKAVMLAHDLLVAKTNDIMVAGGM
ESMSNAPYLLPKARGGYRLGHGTVLDHMFLDGLEDHYREDTRGRLMGTFAEDCAATYGFT
RDAQDEWAVSSTLRAQAAMEAGDFDWETVPITLEGRKGPVQVRSDEQPRKADLNRVSTLK
PAFRKDGTVTAANSSSISDGAAAMVLARQSVAETMGLQPIARIVGHATHAQTPATFTTAP
IGAIHKLLGQLEWSASEVDLWEINEAFAVVAMAAVRDLRLDREKVNIHGGACALGHPIGA
SGARILVTLLGALKKTGGRRGIASLCIGGGEATAVAVEMA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactcaaacatcgaccccatcgtcatcctgtctgcagcgcgaacgccaatgggc
ggttttcagggagagttgtccccattgacggccccggagctgggaggcgctgccattcgt
gcggccgtggagcgcgcgaacgtaaatgaaacgtctatccaggaattgctcatgggatgc
gtgctgccggctggtgtcggccaggctccggcgcgacaggccggcattcacggcggcctg
agtctgtccgtgccgtgcaccacgatcagcaaggtatgcgggtccggcatgaaggcggtc
atgttggcgcacgacctgcttgtggcaaagaccaacgacatcatggtcgcgggcggcatg
gagtcaatgtccaatgcgccctacctgttgccgaaggctagaggcgggtatcgactgggt
cacgggacggtcctggaccacatgttcctcgatggccttgaagaccattaccgcgaagac
acgcgcgggcgtttgatgggaacttttgcggaggactgtgctgctacgtacggattcaca
agagatgcgcaagacgaatgggcggtgtcgtccacgctgcgtgcgcaagccgcaatggaa
gctggggactttgactgggagaccgtgccaatcacgttggagggtcgcaaggggcctgtg
caggtaagaagtgatgagcagccccgcaaggctgatctgaaccgtgtttccaccctgaag
cccgctttcaggaaagacgggacggtaacggcggcaaactccagttcgatctcggatggg
gctgccgcaatggttcttgcgcggcaatccgtcgcagagacgatggggctgcaaccgatt
gcgaggatcgtcggtcacgcgacacacgcgcaaactcccgcgacattcaccactgcgcca
atcggggcgatccacaagctgctcgggcaactggaatggtccgcatcggaagtcgatctt
tgggagatcaacgaagcattcgcggttgtcgcaatggcggccgtgcgcgatctccggctg
gaccgggagaaggtcaatatccacggtggcgcctgtgccttgggtcaccccatcggcgct
tcgggtgcgcggatcctggtcacgctgttgggagcgcttaagaaaactggcggccgtagg
gggatcgccagcctgtgtattggcggtggtgaggcgaccgccgttgcggttgagatggcc
tga

DBGET integrated database retrieval system