KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6505
Entry
Reut_D6505        CDS       T00268                                 
Name
(GenBank) CagE, TrbE, VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:reu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Reut_D6505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reu02044]
    Reut_D6505
Enzymes [BR:reu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Reut_D6505
Secretion system [BR:reu02044]
 Type IV secretion system
  Trb secretion system protein
   Reut_D6505
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 ABC_tran
Other DBs
NCBI-ProteinID: AAZ65803
UniProt: Q6UP60
Position
p1:59998..62556
AA seq 852 aa
MIEAIAIAIAVLGAVLLLILFARIRAVDAELKLKKHRAKDAGLADLLNYAAVVDDGVIVG
KNGSFMAAWLYKGDDNASSTEEQREMVSFRINQALAGLGNGWMVHVDAVRRPAPNYSERG
VSSFPDSVSFAIDEERRRLFEGLGAMFEGYFVLTVTWFPPVLAQRKFVELMFDDDAVAPD
HTARTTGLIAQFKREITSLESRLSSAVKMTRLRGQKVVSEEGREVTHDDFLSWLQFCVTG
LHHPVMLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVAIEGFPLESTPGVLSALAELP
SEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQDAAAMVGDAEA
AIAEVNSGLVAAGYYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFR
LNLHVRDLGHTFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAGIRAAT
KGKSGLHFTVAADDDRLAFCPLQFLETKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNA
IMSMHASGARTLSEFSVTIQDEAIREAIKQYTVDGSMGHLLDAEEDGLSLSDFTVFEIEE
LMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLMLGHPAFRAKIREWLKVLRKAN
CLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMGLNARQIEILA
TAIPKRQYYYVSENGRRLYDLALGPMALAFVGASDKESVATIKSLEAKFGHEWVHEWLAG
RGLNLNDYLEAA
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgatcgaagcaatcgcaattgccattgctgtgctcggtgcggttctgttgctcatcctc
tttgcccgcatccgggctgtcgatgccgagctgaagctcaagaagcatcgcgccaaggat
gccggcctggccgatctgctcaattacgccgccgtggtcgatgacggcgtgatcgtgggc
aagaacggctcctttatggccgcctggctgtacaagggtgatgacaacgccagcagcacc
gaggaacagcgggaaatggtgtcgttccgcatcaaccaggccctggcgggcctggggaac
ggctggatggtgcatgtcgatgctgtgcgtcggcctgcgccgaactactcggagcggggc
gtgtcatcgttccccgactccgtttccttcgccattgacgaggaacgccggcgcttgttc
gagggcctgggcgcgatgttcgagggctactttgtcctgaccgtcacgtggttcccgcca
gtgctggcccagcgcaagtttgtcgaactcatgttcgatgacgatgcggtggctcccgac
catacggcgcgcactacgggcctgattgcgcagttcaagcgcgagatcaccagcctggaa
tcgcgcctgtcctcggcggtcaagatgacgcgcctgcgcggccaaaaagtcgtgtcggaa
gagggcagggaagtcacgcacgatgacttcctgagctggttgcagttctgcgtgacgggc
ctccatcacccggtcatgctgcccagcaatccgatgtacctcgatgcggtaatcggcggg
caagagctgtggggcggcgtcgtgcccaagatcgggcgcaagttcatccaggtggtcgcc
atcgaaggcttccccttggagtcaacgcctggggtgctctcggccctggccgagctgccc
agcgaataccgctggtcgagccgcttcatcttcatggatcagcacgagtccttgaagcac
ctggacaagttccgcaagaagtggaagcagaagattcgcggcttcttcgatcaggtgttc
aacacgaataccggctcgatcaaccaggacgcggccgcgatggtcggcgacgccgaggcg
gccatcgccgaggtcaacagcggcttggtggcggccggctactacaccagcgtagtcgtg
ctgatggacgaggatcgggagcgcctggcggcctccgcgctcctggtcgagaaggccgtc
aaccgcctggccttcgcggcccgtatcgagacgatcaacacgctcgatgcgtacctgggc
agcttgcccggccacggcgtcgagaacgtgcgccggccgctcatcaacacgatgaacctg
gccgacctgctgccgacaagctcgatctggacgggcagcgccacggctccgtgcccgatg
tacccgccgctgtcgccggcgctcatgcactgcgtgacggtgggcgctacgccgttccgc
ctgaacctgcacgtgcgcgacctgggccacaccttcatgttcggcccgaccggcgcaggc
aaatcgacgcacctgggcatcatcgccgcgcagctccgtcgctacgccggcatgtcgatc
tacgccttcgacaagggcatgtcgatgtacccactcgcggccggcatccgcgcggccacg
aagggcaagagcggcctgcatttcacggtggccgccgacgatgaccgcctggcgttctgc
ccgctccagttcctcgaaacgaagggggatagggcctgggcgatggagtggatcgacacc
atcctggcgttgaacggcgtcaacaccacgccggcgcagcgcaacgagatcggcaacgcg
atcatgagcatgcacgccagcggcgcgcgcacgctctccgagttctcggtgacgattcag
gacgaggcgatccgcgaggccatcaagcagtacacggtggacggctcgatgggccacctg
ctcgacgccgaagaggacggcctgtcgctgtccgacttcacggtgttcgagatcgaagag
ctgatgaacctgggcgagaagttcgcgctgccggtgctgctctacctgttccgccgcatc
gagcgcgcactgaaaggccagccctccgtcatcatcctggacgaagcctggttgatgctg
ggccaccccgcgttccgcgccaagatcagggaatggctcaaggtgctgcgcaaggccaac
tgccttgtgctgatggcgacgcaaagcctctccgacgcggccaactcgggcatcttggac
gtgatcgtggaatcgaccgcgaccaagattttcctgcctaacgtctacgccagggatgag
gacacatcggcgctctatcgccgtatgggcctcaacgcgcgtcagatcgaaatcctggcg
actgccattccgaagcgtcagtactactacgtctcggagaacggccgccgtctctatgac
cttgccctggggccgatggccctggccttcgtcggtgcgtccgacaaggaatcggtcgcc
accatcaagagcctcgaagccaagttcggccacgaatgggtgcatgagtggctggccggc
cgtgggctgaatctcaacgactacctggaggccgcatga

DBGET integrated database retrieval system