KEGG   Rhodococcus erythropolis CCM2595: O5Y_15585Help
Entry
O5Y_15585         CDS       T02806                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00010  Glycolysis / Gluconeogenesis
rey00053  Ascorbate and aldarate metabolism
rey00071  Fatty acid degradation
rey00280  Valine, leucine and isoleucine degradation
rey00310  Lysine degradation
rey00330  Arginine and proline metabolism
rey00340  Histidine metabolism
rey00380  Tryptophan metabolism
rey00410  beta-Alanine metabolism
rey00561  Glycerolipid metabolism
rey00620  Pyruvate metabolism
rey00625  Chloroalkane and chloroalkene degradation
rey00903  Limonene and pinene degradation
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
rey01120  Microbial metabolism in diverse environments
rey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O5Y_15585
   00053 Ascorbate and aldarate metabolism
    O5Y_15585
   00620 Pyruvate metabolism
    O5Y_15585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O5Y_15585
   00561 Glycerolipid metabolism
    O5Y_15585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O5Y_15585
   00310 Lysine degradation
    O5Y_15585
   00330 Arginine and proline metabolism
    O5Y_15585
   00340 Histidine metabolism
    O5Y_15585
   00380 Tryptophan metabolism
    O5Y_15585
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O5Y_15585
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O5Y_15585
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O5Y_15585
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     O5Y_15585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGT92965
Position
3379772..3381238
Genome map
AA seq 488 aa AA seqDB search
MTLRPADSSALLVDGKLVPGSGGTFEVFNPATEELIGRAAEGTTADMDAAIAAARRAFDE
TEWARDHRFRARCLRQLCDALQSHIEELREITVAEVGAPVMLTSGPQLEGPIGDLRYWAD
LIETYSWEQDLGHASPMGIPTHRRLLKEAVGVVGAITPWNFPHQINFAKLGPALAAGNTI
VLKPAPDTPWCAALVAKVIAEETEIPAGVVNVVTSTDHSLGAQLCSDPRVDLVSFTGSTA
TGRTVMAAAAQTLKKVFLELGGKSAFIVLDDADIKGACSVAAFSVCVHAGQGCALSTRLL
VPRARYEDALAAACAAMAGIRAGDPSARGTVCGPVISARQRARVESYLALAVEEGGTIVT
GGGRPDDHQSGFFVEPTLIAGLDNSSRVAQEEIFGPVLVIIPYDNDDDAIRIANDSPYGL
SGSVWGADPDRVAHVVAGVRTGTLSVNGGVWYSADAPFGGYKQSGIGREMGLAGFEEYLE
TKLVASPS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcgacccgcagacagttctgcacttctcgtcgacggaaagctggttcccgga
tccggtggaaccttcgaagttttcaacccggccaccgaggaactgatcggccgtgcggcc
gaaggcaccaccgcggacatggatgcggccattgccgctgcgcgccgtgcgttcgacgag
accgaatgggcacgcgatcacaggtttcgcgctcgctgcctgcgccaactgtgcgacgca
ctccagtcccacatcgaggagttgcgtgagatcaccgtcgccgaggtcggcgcacccgtc
atgctgacgagcggtccgcaactcgaaggcccgatcggagatcttcgctactgggctgac
ctgatcgaaacctattcgtgggaacaagatctcgggcacgcgtcacccatggggattcct
acccatcgccgactgctcaaggaagcggtcggcgtcgtcggcgcaatcacaccgtggaac
ttcccgcaccagatcaatttcgccaaactcggccccgccctcgcggccggcaacaccatc
gttctcaaacccgcgccggacacgccctggtgcgccgcgctggtcgccaaggtgattgca
gaagaaaccgagatcccggcgggcgtcgtcaacgtggtgacgtcgacagatcactctctc
ggcgcgcagctgtgcagcgatccgcgcgtcgatctcgtgtccttcaccggttccaccgcc
accggacgcacggtgatggccgcggccgcgcaaaccctcaagaaggtcttcctcgaactc
gggggcaagtccgcattcatcgtcctcgacgacgcggacatcaagggtgcatgctcggtt
gccgcgttctccgtgtgcgttcatgccggtcagggatgcgcactcagtaccagacttctc
gtgccgcgcgctcggtacgaagatgctctggccgcggcctgcgccgcgatggcgggtatc
cgagccggtgaccccagcgcgcgcggaacggtgtgtggtccggtcatctccgcgcgccag
cgcgccagggtggagagctacctcgccctcgcggtcgaagagggcggcacgatcgtgacg
ggtggaggccgacccgacgatcaccagagcggcttcttcgtcgaacccactctcattgcc
gggctggacaactcgtctcgcgtagcgcaggaggagattttcgggcccgttctcgtgatc
attccgtacgacaacgacgacgacgctatccggattgccaacgattccccctacggcctg
tccgggtcggtgtggggcgccgatcccgatcgtgtcgcgcacgtcgttgccggtgtcaga
accggaacgctgagcgtcaacggcggcgtctggtattcggccgacgcaccgttcggcggc
tacaaacaatccgggatcggccgcgaaatgggcctcgccggtttcgaggaatacctcgaa
accaagctcgtcgcttcaccttcctga

DBGET integrated database retrieval system