KEGG   Rhodococcus erythropolis CCM2595: O5Y_20480Help
Entry
O5Y_20480         CDS       T02806                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00450  Selenocompound metabolism
rey00970  Aminoacyl-tRNA biosynthesis
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    O5Y_20480
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O5Y_20480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rey01007]
    O5Y_20480
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rey03016]
    O5Y_20480
Enzymes [BR:rey01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     O5Y_20480
Amino acid related enzymes [BR:rey01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   O5Y_20480
Transfer RNA biogenesis [BR:rey03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    O5Y_20480
 Prokaryotic type
   Other AARSs
    O5Y_20480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGT93921
Position
4526988..4528586
Genome map
AA seq 532 aa AA seqDB search
MTVPASPSQTPRPDSAAPEGAERSPFYITTAIAYPNGAPHIGHAYEYISSDALARFKRLD
GHEVFFMTGTDEHGLKMQQTAIKEGIDVRELAARNSDVFQNLDKVLNISYDRFIRTTDAD
HQVASKAIWEKMAASGDIYLDTYSGWYSVRDEAFYTEAETTLLEDGTRQSTETGTPVEWT
EESNYTFRLSAYGERLLALYEEHPEFIAPTTRRNEIVSFVKGGLKDISISRTTFDWGVKV
PGDPDHVMYVWVDALTNYLTGVGYPNVDSEEFKKFWPASLHIIGKDITRFHTVYWPAFLM
SAGIELPERVFVHGFLYNKGEKMSKSVGNVVDPIAMVDQYGLDAVRFFLLREISYGQDGS
YSHEAIVTRMNADLSNELGNLAQRSLTMVAKNCDAQVPTPGEFTEDDLAMLASADALLAK
CRSEFDVQALHLALEAIWGVLGETNRYFSKQEPWVLRKTDPARMATVLYVTLEVVRIVGL
LVQPVMPDAASRILDLLGQSEENRQFADIAVRIDANRKLPAPAPVFPRFVEE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcctgcctcaccctcccagaccccgcgcccggactccgccgccccggaaggc
gcggaacgatcgccgttctacatcacgacagcgatcgcgtatcccaacggcgctccgcac
atcggccacgcgtacgagtacatctcctcggacgcgctcgcccgcttcaagcgtttggac
ggtcatgaagtgttcttcatgaccggtaccgacgagcacggtctgaagatgcagcagaca
gcgatcaaagagggcatcgacgtacgcgaactcgcggctcgaaactccgacgtgttccag
aacctcgacaaggtcctgaacatctcgtacgaccggttcatccgcaccacggacgctgat
caccaggtcgccagcaaggcgatctgggagaagatggccgcatccggcgacatctacctc
gacacgtactcgggttggtactcggttcgggacgaggccttctacaccgaagccgagacc
acgcttctggaggacggcacccgtcagtccaccgagaccggcaccccggtggagtggacc
gaggagtcgaactacaccttccgcctctcggcgtacggggagcgtctcctcgcgctgtac
gaagagcaccccgaattcatcgcccccacgactcgccgcaacgagatcgtcagcttcgtc
aagggcggcctcaaggacatctcgatctcgcgcaccacgttcgactggggcgtcaaggtg
ccgggcgacccggaccacgtcatgtacgtctgggtagacgccctcaccaactacctgacg
ggcgtcggatacccgaacgtcgattcggaggagttcaagaagttctggcccgcgagcctg
cacatcatcggcaaggacatcacgcggttccacaccgtgtactggccggcattcctcatg
tctgccggcatcgaactgccggagcgggtgttcgtccacggcttcttgtacaacaagggc
gagaagatgtcgaagtccgtcggcaacgtcgtcgaccccatcgcgatggtcgatcagtac
ggcctcgacgcggtccgcttcttcttgctccgcgagatctcgtacggtcaggacggcagc
tacagtcacgaagcgatcgtgacgcgcatgaatgctgatctctcgaacgaactcggcaat
ctcgcgcagcgttcgctgacgatggtcgcgaagaactgcgacgcccaggtacccaccccc
ggcgagttcaccgaggacgacctggcgatgctggcatcggcggatgccctgctcgccaag
tgccgcagcgagttcgacgtgcaggctctgcatctcgcactggaagccatctggggcgtt
ctcggcgagaccaaccggtacttctccaagcaggaaccgtgggttctgcgtaagaccgat
ccggcacgcatggcgacggttctgtacgtgacgctcgaagtggtccgtatcgtcgggctt
ctcgttcagccggtgatgcccgacgcggcgtcacgcatcctcgatctgctcggccagagc
gaagagaaccggcagttcgccgacatcgcggttcgcatcgacgccaaccggaaactgcct
gctccggcgccagttttcccccgcttcgtcgaggaatga

DBGET integrated database retrieval system