KEGG   Rhodococcus erythropolis CCM2595: O5Y_25125Help
Entry
O5Y_25125         CDS       T02806                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00071  Fatty acid degradation
rey00280  Valine, leucine and isoleucine degradation
rey00310  Lysine degradation
rey00362  Benzoate degradation
rey00380  Tryptophan metabolism
rey00620  Pyruvate metabolism
rey00630  Glyoxylate and dicarboxylate metabolism
rey00640  Propanoate metabolism
rey00650  Butanoate metabolism
rey00900  Terpenoid backbone biosynthesis
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
rey01120  Microbial metabolism in diverse environments
rey01130  Biosynthesis of antibiotics
rey01200  Carbon metabolism
rey01212  Fatty acid metabolism
rey02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O5Y_25125
   00630 Glyoxylate and dicarboxylate metabolism
    O5Y_25125
   00640 Propanoate metabolism
    O5Y_25125
   00650 Butanoate metabolism
    O5Y_25125
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O5Y_25125
   00072 Synthesis and degradation of ketone bodies
    O5Y_25125
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O5Y_25125
   00310 Lysine degradation
    O5Y_25125
   00380 Tryptophan metabolism
    O5Y_25125
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O5Y_25125
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O5Y_25125
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O5Y_25125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rey04147]
    O5Y_25125
Enzymes [BR:rey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O5Y_25125
Exosome [BR:rey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O5Y_25125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Death
Motif
Other DBs
NCBI-ProteinID: AGT94842
Position
5477336..5478547
Genome map
AA seq 403 aa AA seqDB search
MPDVVICEPLRTPVGRFGGVFRDVAPEDLASTLIAELVTRTGISGAEIDDVILGQASPNG
EAPAIGRIAALNAGLGVDVPGMQVDRRCGSGLQAIIQAVMQVQSGGSDLVLAGGAESMSQ
AEFYATGMRWGVKGEGVALSDRLARARVTAGGRDFPVPGGMIETAENLRAEFSISREDQD
ALAVQSHQRAVAAQKNGVFAEEIVPVSVPQRKGEALLVDTDEHPRADTSMESLARLRPMR
AKIDPDSTVTAGNASGQNDGAALAIVTTADKARALGLRPLARLASWSVAGVPPRTMGIGP
VPASEKALGRLGLTLADMDVIELNEAFAAQALAVLQSWKLEADDPRVNPNGSGISLGHPV
GATGGRILATLLREMDRREARYGLETMCIGGGQGLAAVFERLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgttgtcatctgtgaaccgctccgtacccctgtcggccgtttcggcggtgtc
ttccgtgacgtagccccggaagatctcgcctcgacgttgatcgccgaactcgtcacgcgt
accggcatttccggcgcggagatcgacgacgtcattctcggccaggcttcgccgaacggt
gaagctccggcgatcggacgcatcgcggcgctcaacgccggtctgggcgtcgatgttccc
ggcatgcaggtggatcgccggtgcgggtcgggattgcaggcaatcatccaggccgtcatg
caggttcagtccggtggcagtgatctggtcctcgcgggtggtgccgagtcgatgagccag
gctgagttctacgcaaccggaatgcgttggggtgtcaagggtgaaggtgttgcgctcagc
gatcgtctcgcgcgcgctcgcgtgacagccggcggacgcgacttcccggttcccggcgga
atgatcgaaacggcagagaacctgcgcgccgagttctccatcagccgcgaagatcaggac
gcactcgcggtgcagtcgcatcagcgtgctgttgctgcacagaagaacggcgtcttcgcc
gaggaaatcgttccggtatccgttccgcagcgcaagggtgaggccctgctcgtcgacacc
gacgagcatccgcgggccgacacttcgatggaatcgcttgcacgccttcgtcccatgcgc
gcaaagatcgacccggactccaccgtgacggcaggtaatgccagcggccagaacgacggc
gcagcgctggcgatcgtcaccaccgcagacaaagcccgcgcactcggactgcgacccctc
gcacgcctggcaagttggagcgttgccggagttcccccgcgcaccatgggcatcggtccc
gtcccggcgtcggagaaggcactcggccgcctcggattgaccctggcggacatggatgtc
atcgaactcaacgaagcctttgcggcacaagcacttgcagtcctgcagagttggaagctc
gaagccgacgacccacgcgtcaaccccaacggctccggcatctccctcggccatccggtc
ggtgccacgggtggacgaatcctggccaccctgttgcgcgagatggaccgtcgcgaagcg
cgttacggcctcgagacgatgtgcatcggcggcgggcagggcctggctgcagtgttcgag
cgcctgtcctga

DBGET integrated database retrieval system