KEGG   Rhodococcus erythropolis CCM2595: O5Y_28600Help
Entry
O5Y_28600         CDS       T02806                                 

Definition
(GenBank) epoxide hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00361  Chlorocyclohexane and chlorobenzene degradation
rey00625  Chloroalkane and chloroalkene degradation
rey01100  Metabolic pathways
rey01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O5Y_28600
   00361 Chlorocyclohexane and chlorobenzene degradation
    O5Y_28600
Enzymes [BR:rey01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     O5Y_28600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AGT95537
Position
6203446..6204144
Genome map
AA seq 232 aa AA seqDB search
MREKIKALLFDVQGTATDFHSTLCREARRITDADVDWPRFVNLWRAEYFANTSEADDSTG
EWVTVHSVYREALRKLLARESIELSDAEQEELTTAWKFLDPWPDTVAGLTTLRQQYTIAA
LSNADVNAAVSISRHGNLPWHAVFTAEMAGVFKPDPKIYHLAARYLGFDTAEIMMVASHK
YDIRAAKALGFRTAFIARPLEFGARGNPDVSFSDEFDINAEDFLDLAAQLVH
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgagaagatcaaagcactgctgttcgacgtccagggcacagcgaccgattttcac
agcaccctgtgccgcgaggcccgtcggatcaccgacgccgacgtcgactggccaagattc
gtcaatctctggcgcgctgagtacttcgcgaacacctccgaggccgacgactccacaggc
gaatgggtgacagtacattcggtgtaccgcgaggctctgcgcaagctgttggcccgcgag
agcatcgaactttccgatgccgaacaggaagaactcaccaccgcctggaaattcctggac
ccgtggccggacaccgtcgcaggcctgacaaccctgcgccagcagtacacaatcgctgcc
ttgtccaacgccgatgtgaatgccgcagtcagcatctcccggcacggaaatctgccatgg
catgccgtcttcaccgccgaaatggccggtgtcttcaaaccagatccgaagatctaccac
ctggctgctcgatacctcgggttcgacacggccgagatcatgatggttgccagccacaaa
tatgacatccgggcggccaaagctctcgggttccgcacagccttcatagcccgaccactc
gaattcggagccaggggcaatcccgatgtgtcattctccgacgagttcgacatcaacgcc
gaggactttctggatctggcagcacaattggtccactga

DBGET integrated database retrieval system