KEGG   Rhizobium esperanzae: AMJ99_CH00532Help
Entry
AMJ99_CH00532     CDS       T05681                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
rez  Rhizobium esperanzae
Brite
KEGG Orthology (KO) [BR:rez00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AMJ99_CH00532 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ANL02128
Position
complement(539377..539781)
Genome map
AA seq 134 aa AA seqDB search
MVQGMYRALTRDIEVVVEPFYLEEQSDPEDDRYVWGYRIVISNNSGVAVRLVNRYWNITD
QNGQVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQMETDEGELFDVDIP
AFSLDSPGLLRVLN
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaggcatgtatcgcgccctcacaagagatatcgaagtcgtggtcgaaccgttc
tatctggaggagcaatccgatccggaggacgatcgctatgtctggggttaccggattgtc
atcagcaacaattccggcgtcgccgttcgcctcgtcaaccgctactggaacatcaccgat
cagaacggacaggtggacgaggtgaccggccccggcgtcgtcggcgaacagccgcggctc
agccccggcgacacctacgaatattcctccggctgcccgctcgacacgccctcaggcctg
atgttcggccactatcagatggaaacggatgaaggcgagctgttcgacgtcgacatcccc
gccttctcgctggattcgccggggctgttgcgcgtgctgaattga

DBGET integrated database retrieval system