KEGG   Rhizobium esperanzae: AMJ99_CH01593Help
Entry
AMJ99_CH01593     CDS       T05681                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rez  Rhizobium esperanzae
Pathway
rez00230  Purine metabolism
rez00240  Pyrimidine metabolism
rez01100  Metabolic pathways
rez01110  Biosynthesis of secondary metabolites
rez01130  Biosynthesis of antibiotics
Module
rez_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rez_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
rez_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AMJ99_CH01593 (ndk)
   00240 Pyrimidine metabolism
    AMJ99_CH01593 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rez04131]
    AMJ99_CH01593 (ndk)
Enzymes [BR:rez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AMJ99_CH01593 (ndk)
Membrane trafficking [BR:rez04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AMJ99_CH01593 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ANL03173
UniProt: A0A246DRQ8
Position
1577161..1577583
Genome map
AA seq 140 aa AA seqDB search
MAIERTFSMIKPDATKRNLTGAITKMLEDAGLRVVASKRVWMSRREAEGFYAVHKDRPFF
GELVEGMTSGPTVVQVLEGEGAILKNREIMGATNPANADEGTIRKVHALSIGENSVHGSD
APETAAQEIKYWFSDTEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgcaccttctcgatgatcaagccggacgcaaccaagcgcaacctgacg
ggcgccatcaccaagatgctcgaagatgccggcctgcgcgtcgtcgcctccaagcgcgtc
tggatgagccgccgcgaagctgaaggcttctacgccgttcacaaggatcgccccttcttc
ggcgaactcgtcgaaggcatgacctccggcccgaccgtcgtccaggttctggaaggcgaa
ggcgcgatcctgaagaaccgcgagatcatgggcgcgaccaacccggcaaacgcagatgaa
ggcacgatccgcaaggtccatgcgctgtcgatcggcgaaaactccgtgcacggctctgac
gctccggaaacggctgcccaggaaatcaagtactggttctccgacactgaaatcgtcggc
tga

DBGET integrated database retrieval system