KEGG   Rhizobium esperanzae: AMJ99_CH01706Help
Entry
AMJ99_CH01706     CDS       T05681                                 

Definition
(GenBank) glutathione peroxidase protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rez  Rhizobium esperanzae
Pathway
rez00480  Glutathione metabolism
rez00590  Arachidonic acid metabolism
rez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AMJ99_CH01706
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMJ99_CH01706
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AMJ99_CH01706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANL03283
Position
1695111..1695659
Genome map
AA seq 182 aa AA seqDB search
MTGNVLDIPVKTVDGRQTTLNEYKGRVLLIVNVASKCGLTPQYEGLERLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTTTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVKTTG
EGPMRERLKSHGISGGDEDDILWNFEKFLIGRGGQIAARFAPDVTADDSRLVSAVDQELA
KG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgtgctggatattccggtcaagacggtggatggtcgacagaccacgctg
aacgaatacaagggcagggtgcttctgatcgtcaatgtcgcctcgaagtgcgggctcacg
ccgcaatatgaggggcttgaaagactctatggcgaaaagcgcgagcgcggcttcgtcatc
gccgctttccccgccaacgacttcaagggccaggaacccggcaccgacgccgagatcctc
gatttctgcaccaccacctacgacgtcactttcccgattttttctaagatttcggtcaag
ggcgaggcccagcacccgctctaccggcagctgaccaaatcgggcgtgaagacgacgggc
gagggtccgatgcgcgaacgcctgaaatcccacggcatatcaggcggcgacgaggatgac
atcctctggaatttcgaaaaattcctgatcggccgcggcggccaaatcgccgcccgcttc
gcgcccgatgtgacggcagacgattcgcggctggtttcggcggtggatcaagagctggcg
aagggatga

DBGET integrated database retrieval system