KEGG   Rhizobium esperanzae: AMJ99_CH01864Help
Entry
AMJ99_CH01864     CDS       T05681                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rez  Rhizobium esperanzae
Pathway
rez00360  Phenylalanine metabolism
rez00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rez00790  Folate biosynthesis
rez01100  Metabolic pathways
rez01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AMJ99_CH01864 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMJ99_CH01864 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMJ99_CH01864 (phhA)
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AMJ99_CH01864 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ANL03424
UniProt: A0A246DP75
Position
complement(1838748..1839539)
Genome map
AA seq 263 aa AA seqDB search
MTKESSYTAKLPGPDGLYDYTPEEDAIWGELYRRQMKLLADKACQEYLDGVKLLGLRPEK
VPQLLDVNRRLNETTGFGVEGVPALIPPSRFYELLSQGKFPLATFLRRREHIDYIEEPDL
FHEVFGHCPLLTNQSYANFVRHFGETAMRLGKGYSWHLFRIFWFTVEFGLINTPQGRRCF
GAGIVSSPSEAKAATEGTGCEFRPFDLLSVLRTPYRIDILQPIYYVIDSFADLEAIVEQD
IGGAILKAKSLGDFAPAFEAKAS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggaaagcagctacaccgccaaactgcccggcccggacggcctttatgactat
acccccgaagaagatgcgatctggggcgaactctaccggcgtcagatgaagctcttggcc
gataaggcttgccaggaatatctggacggcgtcaaactgctggggctcaggccggagaaa
gtgccgcagctcctcgatgtgaacagacgcctgaacgagaccaccggtttcggcgtggaa
ggcgtgccggcgctcattccgccctcgcgcttctatgaacttctatcgcagggcaagttc
ccgctggcgaccttcctgcgccgccgcgagcatatcgattatatcgaggaaccggacctg
ttccacgaagtgttcggccactgcccgctgctgaccaatcagagctatgccaatttcgtc
cggcacttcggcgaaactgccatgcgcctcggcaagggctattcatggcatctgttccgg
attttctggttcacagtcgaattcggcctgatcaacacgccgcaaggccgccgctgtttc
ggcgccggcatcgtctcttctccgagtgaagccaaggcggcaacggaaggcacgggatgc
gaattccggccgttcgatctgttgagcgtgctccggacgccctaccgcatcgatatcctc
cagccgatctactatgttatcgacagctttgccgatctcgaggcgatcgtggagcaggat
atcggcggcgcgatcctcaaggcgaaatcgctgggggatttcgccccggctttcgaagcc
aaggcttcgtaa

DBGET integrated database retrieval system