KEGG   Rhizobium esperanzae: AMJ99_PA00177Help
Entry
AMJ99_PA00177     CDS       T05681                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rez  Rhizobium esperanzae
Pathway
rez00625  Chloroalkane and chloroalkene degradation
rez00680  Methane metabolism
rez01100  Metabolic pathways
rez01120  Microbial metabolism in diverse environments
rez01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AMJ99_PA00177 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMJ99_PA00177 (fdhA)
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AMJ99_PA00177 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ANL06073
Position
pRspN561a:complement(180354..181544)
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLILGHEITGEIIEKGVDVEMLDIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPARA
GGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIRDLTMLSDILPTGFHGAV
RAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKDRLAHAAKVGFEPIDLSKS
DRLGDMIAEVVGTNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGNLSLRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHDRLPIADIVN
AKVIPLDDAAAGYESFDHGAATKYVLDPHGEVAKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaatagaggcgtcgtttatttgaggccgggcaaggtcgaagttcgcgacatc
gacgacccgaagctggaagcgcccgatggccgccgcatcgagcacggcgtgatcctgaag
gttatctccaccaacatctgcggctccgaccagcacatggtccgcggccgcacgacggca
atgccgggcctgatcctcggccatgaaatcaccggcgaaatcatcgagaaaggcgtcgac
gtcgagatgctcgacatcggcgatatcgtctcggtgccgttcaacgttgcctgcggccgc
tgccgctgctgcaaatctcaggatacgggcgtctgcctgacggtaaacccggcccgcgcc
ggcggcgcttacggttatgtcgacatgggcggctggatcggcgggcaggcacgctacgtc
actattccctatgccgatttcaacctgctaaaaatcccggatcgcgacaaggcaatggcg
aagatccgcgatctcaccatgctttccgacattctgcccaccggctttcacggtgcagtg
cgcgcaggcgtcggggtcggatcgaccgtctacgtcgccggcgccggcccggtcgggctt
gcggctgcggcttcggctcgcatcctcggcgccgccgtcgtcatgatcggtgacttcaac
aaggatcgcctggcgcatgcggcgaaagtcggcttcgagccgatcgatctctcgaagagc
gaccgtctcggcgacatgatcgccgaggtggtcggcacgaatgaggtggacagcgccatc
gatgcggtcggcttcgaggcgcgtggccattccggcggagaacagccggcgatcgtgctc
aatcagatgatggagatcacccgcgccgcaggttcgattggtattcccggcctctatgtg
accgaggatccgggcgccgtcgacaatgccgccaagcacggcaatctgtcactccgcttc
ggtctcggctgggcaaaagcacaatccttccacaccggccagacgccggtgctgaaatat
aatcgccagctcatgcaggcgatccttcacgaccggttgccgatcgccgatatcgtcaac
gcgaaggtcatcccgctcgacgatgccgccgctggatatgaaagtttcgaccatggcgcg
gcaacgaagtatgtcctcgatccgcacggagaggtggcgaaagccgcctga

DBGET integrated database retrieval system