KEGG   Rhizobium esperanzae: AMJ99_PD00437Help
Entry
AMJ99_PD00437     CDS       T05681                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD(+)) protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rez  Rhizobium esperanzae
Pathway
rez00010  Glycolysis / Gluconeogenesis
rez00053  Ascorbate and aldarate metabolism
rez00071  Fatty acid degradation
rez00280  Valine, leucine and isoleucine degradation
rez00310  Lysine degradation
rez00330  Arginine and proline metabolism
rez00340  Histidine metabolism
rez00380  Tryptophan metabolism
rez00410  beta-Alanine metabolism
rez00561  Glycerolipid metabolism
rez00620  Pyruvate metabolism
rez00625  Chloroalkane and chloroalkene degradation
rez00903  Limonene and pinene degradation
rez01100  Metabolic pathways
rez01110  Biosynthesis of secondary metabolites
rez01120  Microbial metabolism in diverse environments
rez01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMJ99_PD00437
   00053 Ascorbate and aldarate metabolism
    AMJ99_PD00437
   00620 Pyruvate metabolism
    AMJ99_PD00437
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMJ99_PD00437
   00561 Glycerolipid metabolism
    AMJ99_PD00437
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMJ99_PD00437
   00310 Lysine degradation
    AMJ99_PD00437
   00330 Arginine and proline metabolism
    AMJ99_PD00437
   00340 Histidine metabolism
    AMJ99_PD00437
   00380 Tryptophan metabolism
    AMJ99_PD00437
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMJ99_PD00437
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMJ99_PD00437
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMJ99_PD00437
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AMJ99_PD00437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2917 NIR_SIR_ferr
Motif
Other DBs
NCBI-ProteinID: ANL07491
Position
pRspN561d:465349..466812
Genome map
AA seq 487 aa AA seqDB search
MTLSFDPNSISLPMGHFIGGRLVPAEAVIDMHRPSDGKPYAGCPLADAALVDQAVETARG
ALDRSNWGGVRPRDRTKALQRWADLIEAEAETLAKLEALSSTRPVGHLVAGDIAVTAEQI
RFFAEFADKEGGDLVPTDDANFGMIVTEPYGVVGAITPWNFPLSMAGWKLAPALAAGNAV
VLKPSEMTPFSTLYLAELSVRAGLPAGLVNVVLGDGPITGTAITGHPGISKVSFTGSTTA
GAAIMANIARTGVKPMTLELGGKSPQLVFADADLDLAAGAIATSILSNAGQACICGSRLI
VEAKVADALVAALVARLAAVRPGPTWEETTDYSPVISERQIARMDGIIRAAIDGGAECLA
GGGRLDREGYFYAPTLISGVTATSPAVLEEIFGPVLTIQTFEDEEEALSLADHPSYGLAA
GLFTRDLSRAIRLTRRLQAGTVWVNRYGRSRDHILPTGGYKQSGIGKDLGREAYHANRKS
KSVLISL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacactcagcttcgatccaaactcgatttccctgcccatgggacatttcatcggcggc
cggctggttccggccgaagccgtcatcgatatgcatcggccgtccgacggcaagccctat
gccggctgtccgcttgccgacgcagctcttgtcgatcaggccgtggagacggcaaggggg
gcgttggatagaagcaattggggtggtgtgcggccgcgcgatcgcaccaaggcgctgcag
cgctgggcggacctgatcgaagccgaggcggagaccctcgccaagctcgaagcgctttcc
tcgacccgccccgtcggccatctcgtcgccggcgatatcgccgtcaccgccgagcagatt
cgcttctttgccgaattcgccgacaaggaaggcggcgatctcgtcccgaccgacgacgcg
aatttcggcatgatcgtgacggaaccctatggcgtcgtcggcgccatcacgccctggaat
tttcccctgtcgatggcaggctggaagcttgccccggcgctggcggcgggcaatgccgtg
gtgctgaagccatcggagatgacgccgttctcgacactctatctcgccgagctttcggtg
cgggccggcctgcccgccggcctcgtcaatgtcgtccttggcgacggtccgatcaccgga
accgccatcaccgggcatcccgggatttccaaagtgagcttcaccggctcgaccacggcc
ggtgcagccatcatggccaatattgcccgcaccggcgtgaagcccatgacgttggagctc
ggcggcaagagccctcagctggtcttcgcggatgccgatctcgaccttgcggcaggcgcc
atcgccaccagcattttgtccaacgccggccaggcctgcatatgcggatcccgcctcatc
gtcgaggcgaaggtggcggacgcgctcgtagcggccctcgtcgccagactggcggcagtc
cgaccggggccgacctgggaggaaacgaccgattattcgcctgttatctccgaacgccaa
atcgcccgcatggatggtatcatccgcgccgccatcgacggcggggccgaatgtcttgcg
ggtggcggccggctcgatcgtgagggctatttttacgcgccgacgctgatttcgggcgtg
accgcaacatcgcccgccgttctcgaggaaatcttcggaccggtcctgaccatccagacc
ttcgaggatgaggaggaggcgctaagcctcgccgaccacccatcctatggcctggccgcg
ggcctcttcacccgcgatctctcgcgcgccatccgcctcacccgtcgcctgcaggccggc
accgtctgggttaaccgttacggccgatcgcgcgaccatatcctgccgaccggcggctac
aagcagtccggcatcggcaaggatctcggccgcgaggcctatcacgccaaccgcaagagc
aagagcgtgctcatcagcctttaa

DBGET integrated database retrieval system