KEGG   Rhizobium esperanzae: AMJ99_PD00479Help
Entry
AMJ99_PD00479     CDS       T05681                                 

Gene name
adhI-2
Definition
(GenBank) bifunctional alcohol dehydrogenase class 3/S-(hydroxymethyl)glutathione dehydrogenase 2
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rez  Rhizobium esperanzae
Pathway
rez00010  Glycolysis / Gluconeogenesis
rez00071  Fatty acid degradation
rez00350  Tyrosine metabolism
rez00625  Chloroalkane and chloroalkene degradation
rez00626  Naphthalene degradation
rez00680  Methane metabolism
rez01100  Metabolic pathways
rez01110  Biosynthesis of secondary metabolites
rez01120  Microbial metabolism in diverse environments
rez01130  Biosynthesis of antibiotics
rez01200  Carbon metabolism
rez01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMJ99_PD00479 (adhI-2)
  09102 Energy metabolism
   00680 Methane metabolism
    AMJ99_PD00479 (adhI-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMJ99_PD00479 (adhI-2)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AMJ99_PD00479 (adhI-2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMJ99_PD00479 (adhI-2)
   00626 Naphthalene degradation
    AMJ99_PD00479 (adhI-2)
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AMJ99_PD00479 (adhI-2)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     AMJ99_PD00479 (adhI-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ANL07533
Position
pRspN561d:complement(514528..515655)
Genome map
AA seq 375 aa AA seqDB search
MDVRAAVATQAGKPLEVMTVQLEGPKAGEVLVEVKATGICHTDDFTLSGADPEGLFPAIL
GHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRECYSCLSRKTNLCTAIRATQGQGLMPD
GTSRFSIGKDKIHHYMGCSTFANYTVLPEIALAKINPDAPFDKVCYIGCGVTTGIGAVIN
TAKVEIGSTAIVFGLGGIGLNVLQGLRLAGADMIIGVDINPDRKAWGEKFGMTHFVNAKE
VGDDIVPYLVNMTRRGGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSVIIGVAGAGQ
EISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMQGKIQIDPMITHTMPLEDINKGF
DLMHKGESIRGVVVY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacgcgccgccgtggccacgcaggccggaaaaccgctcgaagtgatgaccgtg
cagctggaagggccgaaggccggcgaagtgctggtggaggtcaaggcgaccggcatctgc
cacaccgatgatttcaccctgtcgggagcagatccggaaggcctgttccccgccatcctc
ggccatgagggcgccggcatcgtcgtcgatgtcggcccgggtgtgacctcggtaaagaag
ggcgaccacgtcattccgctttatacgcccgaatgccgcgagtgttattcctgcctgtcg
cgcaagaccaatctctgcaccgccatccgcgccacccagggtcagggtctgatgccggac
ggcacctcgcgcttctcgatcggcaaggacaagatccatcactatatgggctgctcaacc
tttgccaattacacggtgctgccggagatcgcgctggccaagatcaatcccgacgcgccc
ttcgacaaggtctgctacatcggctgcggcgtcaccacaggcatcggcgccgtcatcaac
accgccaaggtcgagatcggatcgacggcgatcgtcttcgggctcggcggcatcggcctg
aacgtgctgcagggcctgcggcttgccggcgccgacatgatcatcggcgtcgatatcaac
ccggatcgcaaggcctggggcgagaagttcggcatgacgcatttcgtcaatgcgaaggag
gtcggcgacgacatcgtgccctatctggtcaacatgaccaggcggggcggcgacctgatc
ggcggcgccgactacaccttcgactgcaccggcaacaccaaggtgatgcgccaggcgctg
gaagcatcccatcgcggctggggcaaatcggtcatcatcggggttgccggcgccggccag
gaaatctcgacgcggccgttccagctggtgaccggccgcaactggatgggcaccgccttc
ggcggcgcgcgcggccgcaccgacgtgccgaagattgtcgactggtacatgcagggcaag
atccagatcgatccgatgatcacccacaccatgccgctcgaagacatcaataagggcttc
gacctgatgcacaagggtgaaagcatccgcggcgtggtcgtgtactaa

DBGET integrated database retrieval system