KEGG   Rhodococcus fascians: A3L23_00314Help
Entry
A3L23_00314       CDS       T04328                                 

Gene name
fadA_1
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00071  Fatty acid degradation
rfa00072  Synthesis and degradation of ketone bodies
rfa00280  Valine, leucine and isoleucine degradation
rfa00310  Lysine degradation
rfa00362  Benzoate degradation
rfa00380  Tryptophan metabolism
rfa00620  Pyruvate metabolism
rfa00630  Glyoxylate and dicarboxylate metabolism
rfa00640  Propanoate metabolism
rfa00650  Butanoate metabolism
rfa00900  Terpenoid backbone biosynthesis
rfa01100  Metabolic pathways
rfa01110  Biosynthesis of secondary metabolites
rfa01120  Microbial metabolism in diverse environments
rfa01130  Biosynthesis of antibiotics
rfa01200  Carbon metabolism
rfa01212  Fatty acid metabolism
rfa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3L23_00314 (fadA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    A3L23_00314 (fadA_1)
   00640 Propanoate metabolism
    A3L23_00314 (fadA_1)
   00650 Butanoate metabolism
    A3L23_00314 (fadA_1)
  Lipid metabolism
   00071 Fatty acid degradation
    A3L23_00314 (fadA_1)
   00072 Synthesis and degradation of ketone bodies
    A3L23_00314 (fadA_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3L23_00314 (fadA_1)
   00310 Lysine degradation
    A3L23_00314 (fadA_1)
   00380 Tryptophan metabolism
    A3L23_00314 (fadA_1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3L23_00314 (fadA_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3L23_00314 (fadA_1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3L23_00314 (fadA_1)
Enzymes [BR:rfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3L23_00314 (fadA_1)
Exosome [BR:rfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3L23_00314 (fadA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMY51675
UniProt: A0A161GCJ6
Position
367810..369030
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVATARSPIGRAMKGSLKDIRPDDLTAQMVAAALAKVPSLDPKDIDDLLLGCGLP
GGMQGNNLARIVAVQLGYDSLPGTTITRYCSSSLQTTRMALHAIKAGEGDVFISAGVESV
SSFIHGSSDSLPESHNPIFADAEARTKKAQEEGADSWTDPRENGELPDAYIAMGQTAENV
ALLTGISREDQDRWGVRSQNRAEEAINAGFFEREITPVTLPDGTVVSTDDGPRAGTTYEK
ISQLKPVFRPNGTITAGNACPLNDGAAALVIMSDTKAKELGLTPLARIVSTGVTGTSPEI
MGLGPIEATRKALKIAGMSISDIDLFEINEAFAVQVLGSARDLGIEEDKLNVSGGAIAVG
HPFGMTGARITTTLLNNLTTHDKTFGVETMCVGGGMGMAMVLERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggcagtcatcgtcgccaccgcgcgctcacccatcggcagggcaatgaagggg
tcgctcaaggacattcgtcccgacgacctcaccgctcagatggtcgccgctgcgctggcc
aaggtgccctcgctcgacccgaaggacatcgacgacctgctcctgggctgcggcctgccc
ggcgggatgcagggcaacaacctcgcccgcatcgtcgcggttcagctcggctacgactcg
ctccccggaacgacgatcacgcgctactgttcgtcctcgctgcagaccacccgcatggcg
ctgcacgcgatcaaggcaggcgagggtgacgtgttcatctccgctggtgtcgagagcgtg
tccagcttcatccacggcagctcggattcgcttccggaaagccacaacccgatcttcgcc
gacgccgaggcccgtaccaagaaggcacaggaagagggcgcggacagctggaccgatccc
cgcgagaacggcgagctgcccgacgcgtacatcgcgatgggccagacggccgagaacgtc
gccctgctcaccggcatcagccgtgaggatcaggaccgctggggcgtccgcagccagaac
cgcgccgaagaggccatcaacgccggcttcttcgagcgggagatcaccccggtgaccctg
cccgacggcaccgtcgtcagcaccgacgacggccctcgcgccggcaccacgtacgagaag
atcagccagctcaagcctgtcttccgtccgaacggcaccatcaccgccggtaacgcatgc
ccgctcaacgacggcgcagcagcgctcgtcatcatgagcgacaccaaggccaaggagctg
ggcctgaccccgttggctcgcatcgtgtccaccggcgtcaccggcacgtctcccgagatc
atgggcctggggccgatcgaggccacccgcaaggcgctgaagatcgcgggcatgtccatc
tccgacatcgacctgttcgagatcaacgaggccttcgccgtgcaggtcctcggctcggca
cgcgacctcggcatcgaagaggacaagctcaacgtctccggcggtgccatcgcggtcggc
cacccgttcggcatgaccggtgcccgcatcaccacgactctgctgaacaacctgacgaca
cacgacaagacgttcggcgtcgagaccatgtgcgtcggcggcggcatgggcatggccatg
gtgctcgaacgtctcagctga

DBGET integrated database retrieval system