KEGG   Rhodococcus fascians: A3L23_01000Help
Entry
A3L23_01000       CDS       T04328                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3L23_01000 (gutB_1)
Enzymes [BR:rfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A3L23_01000 (gutB_1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A3L23_01000 (gutB_1)
    1.1.1.-  
     A3L23_01000 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AMY52352
UniProt: A0A161GH40
Position
complement(1080625..1081713)
Genome map
AA seq 362 aa AA seqDB search
MSNKVDADRKANADMTSAVENKFVHVVAPKEAETVVEDTVTPAPDGVVVDIRYCGICATD
THGYASAALPPAVFGHEWTGTISAVGAEVTTVRVGQRVVAGVGPACGVCAQCRAGHAANC
DLAFAEANGITDDAPAHGGFATRLKVSARRAIPVLDALTDEEAALMEPATVTFHAVKRAA
ITLGSIVVVQGAGPIGLLTAQHARTAGAGRVLVSEPSPARRSAATDLGFTDVVEPGDLAT
LIDDVTDGLGADVLFECTGVAALFQPSAELVRRGGTLALLGYPGTDSSVSYGDWQSRELT
VIGSLAYSHEDFKGAMTLIAEGRIDVKSLHTGTIGLGELVNMFDELDSGTSTHAKVLVDP
KL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaagttgatgccgaccggaaagcgaacgctgacatgacatctgccgtcgag
aacaagttcgtccacgtcgtcgcacccaaggaagcggagaccgtggtcgaggatacggtg
acaccggccccggacggggtggtcgtcgacattcggtactgcggcatctgcgcgaccgac
acgcacggatacgcgtcggcagcgttgccgcctgcggtgttcggacatgaatggacgggg
acgatcagcgcggtcggtgccgaggtgacgacggtgcgtgtcgggcagcgtgtggttgcg
ggcgtcgggccggcgtgcggggtgtgcgctcagtgtcgcgccgggcacgcggccaactgc
gatctcgcgtttgcggaggccaacggaatcaccgacgatgcaccggcccacggtggcttt
gccaccaggttgaaagtgtccgcacggcgagcgattccggtgctggacgcgctgaccgac
gaagaggccgcgttgatggagccggctaccgtgacgttccatgccgtcaagcgcgcggcc
atcacgctcgggtcgatcgtcgtggtccagggcgcaggaccgatcggcttgttgaccgcg
cagcacgcgcgcaccgccggcgccggtcgagtgctggtgagcgaaccgtcgcccgcgcgt
cgttcggcggcaaccgatctgggcttcaccgacgtggtggagcccggggacctcgctact
ctgatcgatgacgtcaccgacggtctcggtgccgacgtgctgttcgaatgcaccggcgtg
gccgcgctgttccagccctcggcggagttggtcaggcgaggtggaacgctggcgctgctc
ggctaccccggaacggactcgtcggtgagctacggggattggcagtcccgagaactgacg
gtcatcggttcgctggcgtactcgcacgaagacttcaagggcgcgatgacgctgatcgcc
gagggccgaatcgacgtgaagtcgttgcataccgggacgatcggtctgggtgagctcgtg
aacatgttcgacgagctcgacagcggcaccagcacccatgccaaggtgctggtcgacccg
aaactctag

DBGET integrated database retrieval system