KEGG   Rhodococcus fascians: A3L23_02150Help
Entry
A3L23_02150       CDS       T04328                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00071  Fatty acid degradation
rfa00072  Synthesis and degradation of ketone bodies
rfa00280  Valine, leucine and isoleucine degradation
rfa00310  Lysine degradation
rfa00362  Benzoate degradation
rfa00380  Tryptophan metabolism
rfa00620  Pyruvate metabolism
rfa00630  Glyoxylate and dicarboxylate metabolism
rfa00640  Propanoate metabolism
rfa00650  Butanoate metabolism
rfa00900  Terpenoid backbone biosynthesis
rfa01100  Metabolic pathways
rfa01110  Biosynthesis of secondary metabolites
rfa01120  Microbial metabolism in diverse environments
rfa01130  Biosynthesis of antibiotics
rfa01200  Carbon metabolism
rfa01212  Fatty acid metabolism
rfa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3L23_02150
   00630 Glyoxylate and dicarboxylate metabolism
    A3L23_02150
   00640 Propanoate metabolism
    A3L23_02150
   00650 Butanoate metabolism
    A3L23_02150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3L23_02150
   00072 Synthesis and degradation of ketone bodies
    A3L23_02150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3L23_02150
   00310 Lysine degradation
    A3L23_02150
   00380 Tryptophan metabolism
    A3L23_02150
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3L23_02150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3L23_02150
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A3L23_02150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfa04147]
    A3L23_02150
Enzymes [BR:rfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3L23_02150
Exosome [BR:rfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3L23_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMY53492
UniProt: A0A161GIW2
Position
2235990..2237525
Genome map
AA seq 511 aa AA seqDB search
MSSVRHEASTVDPRRVPVIVAIGETSGRGEPMGVEPMELITRAATEALQDSPTSEPWIRR
ADSITFCHIASWAYASPAAALARRFGATPTDVFDAPIGGQWPARLLDRAASRIASGESTV
AVIAGGEAQASMGALVKAGREPVRDGGWSADPGGPPTFDLDQLGSAAMQDAGLITPVRIY
PLFESRFRFEAGLDPESRLAECSDLYAEFSVVAQENPYSWNGRVRTAADIGTPSPKNRIV
CEPYPLSMNAMPFVDQAACIVVTSLAEARERGVPEGDLVFVWGGAGAEDSVDILDRSDFG
RSPAMEDAMDRALRAAEIGVEQLDVVDVYSCFPIVPTLATRHLGTPKSLVPSVTGGHSSF
GGPLSSHSLHSITASVREIRGGKNCALVHANGGYMTYHHSVLLGGDQHPQGYVGNPEPAV
LTPDPPPRAPVQDGTLVVETVSVEHSRQQEPNQGFVVARDERGRRVAAQTAPGDTASARA
LSLYRTDPAREIIGTTVTVDTIEGNIRVRSS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagtacgccacgaggcgtcgacggtggatccgagacgtgttccggtgatcgtg
gctatcggtgagacaagcggccgcggcgaacccatgggcgtcgaacccatggaactgatc
acgcgcgctgccaccgaggcactccaggattcgccgacgtcggagccgtggattcgcaga
gcggacagcatcacgttctgccatatcgccagctgggcttacgccagtcccgccgctgcg
ctggcccgtagattcggtgccacccccacagatgtgttcgacgcgccgatcggtggtcag
tggcccgcgcgccttctcgaccgcgcagcctcgcgcattgcgtccggggagtcgacggta
gcggtgatcgcgggcggtgaagcgcaggcctcgatgggtgccttggtcaaggccgggcga
gagcccgtgcgggatgggggatggagcgcggacccgggaggtccgcccaccttcgacctc
gatcaactcggaagtgccgcaatgcaagacgccggactgatcactccggttcggatctat
cctttgttcgagagccgcttcagattcgaggccggactggatccggagtctcgactggcc
gagtgcagcgacctgtatgcggagttttccgttgtcgcccaagagaacccgtactcgtgg
aacgggcgagtgcggacggctgccgacatcggcacgccgtcgccgaagaaccgcatcgtg
tgcgagccgtatccgttgtcgatgaacgccatgcccttcgtcgaccaggcggcgtgcatc
gtggtgaccagcttggccgaagcccgagaacgcggtgtccccgagggcgacctcgtgttc
gtctggggcggtgcgggtgccgaggattcggtcgacattctcgaccgcagcgatttcggc
cggtctccagcgatggaggatgcgatggaccgagccttgcgcgccgcagagatcggagtc
gaacaactcgacgtggtcgacgtatacagctgcttcccgatcgtgccgaccctcgccacc
cgacacctcggaacgccgaaatcattggtacccagtgtgaccggtggtcattcgtccttc
ggtggtcccctcagtagtcattcgctgcattcgatcaccgcatccgtccgcgagattcgc
ggcggcaagaactgcgcactggtgcacgcgaacggtggctatatgacgtatcaccactcg
gtgctgctcggtggcgaccagcacccacagggctacgtaggaaatcccgaacccgcagtg
ctgacgccggatccaccgcctcgtgcacctgtacaggacgggactctcgtggtggagaca
gtgtccgtcgagcattctcggcagcaggaaccgaaccaggggttcgtcgtcgcgagagac
gagcgcgggcgacgcgtcgccgcacagacggcacccggggacacggccagcgcccgtgcg
ctgtctctgtatcgaaccgacccggcacgcgaaatcatcgggaccacagtcactgtcgac
accatcgaggggaacatccgtgtccgaagcagctag

DBGET integrated database retrieval system