KEGG   Rhodococcus fascians: A3L23_02181Help
Entry
A3L23_02181       CDS       T04328                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00051  Fructose and mannose metabolism
rfa01100  Metabolic pathways
rfa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A3L23_02181 (fucA)
Enzymes [BR:rfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A3L23_02181 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AMY53523
UniProt: A0A161GFV5
Position
2267259..2267921
Genome map
AA seq 220 aa AA seqDB search
MPADVDELRQSVAETARQLGRRGLVLGTAGNVSARAGDVVAVTATGLVLANATVEDVTLV
GMDAVVRAGACEPTSELGLHLGLYASSEVQAVVHAHSSAAVALSLVADALPPVHYAQLAL
GGRVPVVPFAPFGTAELADAVVAAMRSRSAVIMAHHGSVATGHDLGAALSNIELLEWLCG
VYLCAASVSNPRTLDDAQLAATLDEMVRRAYGTAAPVRRD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgacgtggacgagctacggcagtccgtcgccgagaccgcccggcaactgggc
cgacggggcctggttctcggcaccgcaggcaatgtcagcgcacgcgcgggtgatgtggtg
gcggtgacggcgaccggactggtgttggcgaacgccacggtcgaggacgtcacgctcgtc
ggtatggatgcagtcgtacgtgcaggtgcgtgcgagccgacctcggaactcggcctgcac
ctcggcctctacgcgtcgtccgaggtgcaggcggtggtgcatgcgcattcttctgcagcc
gttgctctttcgctcgtcgcggacgcactgccgcccgtgcactacgcgcagctggccctc
ggcggcagggtcccggtggtgccgttcgcgccgttcggtacggccgagctcgccgacgcg
gtggtggcggcgatgcgttcgaggtcggcggtgatcatggcccatcacggatcggtggcc
accggtcatgatctcggggccgcgctgtcgaacatcgaactgctcgaatggctctgcggg
gtctacctttgcgccgcgtcggtgtcgaacccgcgcaccctcgacgacgcgcagctggcg
gcgaccctcgacgagatggtgcgccgtgcatacggaacagccgcacccgtacgacgagac
tga

DBGET integrated database retrieval system